Drosophila erecta: 6545155 Help Entry 6545155           CDS       T01060                                  Name (RefSeq) RING-box protein 1B   KO K03868   E3 ubiquitin-protein ligase RBX1 [EC:2.3.2.32] Organism der  Drosophila erecta Pathway der03420   Nucleotide excision repair der04120   Ubiquitin mediated proteolysis der04141   Protein processing in endoplasmic reticulum der04310   Wnt signaling pathway der04341   Hedgehog signaling pathway - fly der04350   TGF-beta signaling pathway Brite KEGG Orthology (KO) [BR:der00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     6545155    04120 Ubiquitin mediated proteolysis     6545155   09124 Replication and repair    03420 Nucleotide excision repair     6545155  09130 Environmental Information Processing   09132 Signal transduction    04310 Wnt signaling pathway     6545155    04341 Hedgehog signaling pathway - fly     6545155    04350 TGF-beta signaling pathway     6545155  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:der04121]     6545155    03400 DNA repair and recombination proteins [BR:der03400]     6545155 Enzymes [BR:der01000]  2. Transferases   2.3  Acyltransferases    2.3.2  Aminoacyltransferases     2.3.2.32  cullin-RING-type E3 NEDD8 transferase      6545155 Ubiquitin system [BR:der04121]  Ubiquitin ligases (E3)   UBL E3 ligases    6545155   Multi subunit type E3    SCF complex     Ring finger protein      6545155    Cul2 complex      6545155    Cul3 complex      6545155    Cul4 complex      6545155    Cul7 complex      6545155    Cul8 complex      6545155    Cul9 complex      6545155 DNA repair and recombination proteins [BR:der03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     GGR (global genome repair) factors      Cul4-DDB2 complex       6545155     TCR (transcription coupled repair) factors      Cul4-CSA complex       6545155 SSDB OrthologParalogGFIT Motif Pfam:  zf-rbx1 zf-ANAPC11 zf-RING_2 zf-C3HC4_2 zf-C3HC4 zf-RING_UBOX Bacteriocin_II PHD_NSD Motif Other DBs NCBI-GeneID:  6545155 NCBI-ProteinID:  XP_001971017 UniProt:  B3NEP8 LinkDB All DBs Position Unknown AA seq 122 aa AA seqDB search MAEEMEVEETEDFHDMDFNDEEPSCSGGAGQARTERFVVKKWVAHAMWGWDVAVDNCAIC RNHIMNLCIECQADPNANQDECTVAWGECNHAFHYHCIARWLKTRLVCPLDNKEWVYQKY GH NT seq 369 nt NT seq  +upstreamnt  +downstreamnt atggccgaggagatggaggttgaggagacggaggacttccacgacatggacttcaatgac gaagagccctcctgcagtggaggagctggtcaagccaggacggagcgctttgtggtgaag aagtgggtggcgcacgccatgtggggatgggacgtagcagtggacaactgtgccatctgc cgtaaccacattatgaacctgtgcatcgagtgccaggcggacccgaatgccaaccaagac gagtgcactgtggcttggggcgagtgcaaccacgctttccattaccactgcatcgcgcgc tggttgaagacgcgcctcgtctgcccgctggacaacaaggagtgggtctaccagaagtac ggccactag

DBGET integrated database retrieval system