Desulfoscipio gibsoniae: Desgi_1511 Help Entry Desgi_1511        CDS       T02657                                  Name (GenBank) ferredoxin   KO K00395   adenylylsulfate reductase, subunit B [EC:1.8.99.2] Organism dgi  Desulfoscipio gibsoniae Pathway dgi00920   Sulfur metabolism dgi01100   Metabolic pathways dgi01120   Microbial metabolism in diverse environments dgi01320   Sulfur cycle Brite KEGG Orthology (KO) [BR:dgi00001]  09100 Metabolism   09102 Energy metabolism    00920 Sulfur metabolism     Desgi_1511 Enzymes [BR:dgi01000]  1. Oxidoreductases   1.8  Acting on a sulfur group of donors    1.8.99  With unknown physiological acceptors     1.8.99.2  adenylyl-sulfate reductase      Desgi_1511 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Fer4 Fer4_7 Fer4_6 Fer4_9 Fer4_4 Fer4_2 Fer4_10 Fer4_16 Fer4_21 Fer4_3 Fer4_8 Fer4_13 Fer4_17 Fer4_18 Fer4_15 Fer4_22 Motif Other DBs NCBI-ProteinID:  AGL00997 UniProt:  R4KH88 LinkDB All DBs Position 1537111..1537419 Genome browser AA seq 102 aa AA seqDB search MPPVIDKEKCIGCGACEEICPGDLMEIDEHENKAFCRANRDCWDCMACVKECPNGAIETR IPYQLGYYPAKLIPKKREKEIEWTIIDINANVEKLIVETRNK NT seq 309 nt NT seq  +upstreamnt  +downstreamnt atgccaccagtaatagataaggaaaaatgtataggttgtggagcatgtgaggaaatttgc ccgggggacttaatggaaatagatgagcatgaaaataaagcattctgccgcgccaacaga gattgctgggattgcatggcttgtgttaaagaatgtcctaacggggcaattgaaaccaga attccgtatcaattgggctactatccggcaaaattaattcctaagaagcgggaaaaagag attgagtggactattatcgatattaacgctaacgtagaaaagcttattgtagagactcgt aacaaataa

DBGET integrated database retrieval system