Drosophila grimshawi: 6559441 Help Entry 6559441           CDS       T01061                                  Name (RefSeq) RING-box protein 1   KO K03868   E3 ubiquitin-protein ligase RBX1 [EC:2.3.2.32] Organism dgr  Drosophila grimshawi Pathway dgr03420   Nucleotide excision repair dgr04120   Ubiquitin mediated proteolysis dgr04141   Protein processing in endoplasmic reticulum dgr04310   Wnt signaling pathway dgr04341   Hedgehog signaling pathway - fly dgr04350   TGF-beta signaling pathway Brite KEGG Orthology (KO) [BR:dgr00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     6559441    04120 Ubiquitin mediated proteolysis     6559441   09124 Replication and repair    03420 Nucleotide excision repair     6559441  09130 Environmental Information Processing   09132 Signal transduction    04310 Wnt signaling pathway     6559441    04341 Hedgehog signaling pathway - fly     6559441    04350 TGF-beta signaling pathway     6559441  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:dgr04121]     6559441    03400 DNA repair and recombination proteins [BR:dgr03400]     6559441 Enzymes [BR:dgr01000]  2. Transferases   2.3  Acyltransferases    2.3.2  Aminoacyltransferases     2.3.2.32  cullin-RING-type E3 NEDD8 transferase      6559441 Ubiquitin system [BR:dgr04121]  Ubiquitin ligases (E3)   UBL E3 ligases    6559441   Multi subunit type E3    SCF complex     Ring finger protein      6559441    Cul2 complex      6559441    Cul3 complex      6559441    Cul4 complex      6559441    Cul7 complex      6559441    Cul8 complex      6559441    Cul9 complex      6559441 DNA repair and recombination proteins [BR:dgr03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     GGR (global genome repair) factors      Cul4-DDB2 complex       6559441     TCR (transcription coupled repair) factors      Cul4-CSA complex       6559441 SSDB OrthologParalogGFIT Motif Pfam:  zf-rbx1 zf-ANAPC11 zf-RING_2 zf-C3HC4 zf-C3HC4_2 zf-RING_11 VSP Motif Other DBs NCBI-GeneID:  6559441 NCBI-ProteinID:  XP_001987855 UniProt:  B4J4L7 LinkDB All DBs Position Unknown AA seq 112 aa AA seqDB search MDSEVQQSDAFDDGVTGGGPPSKRFILKKWHGVALWEWDIVVDNCAICRNHVMDPCIECQ ANHYADNGNDCVVAWGSCSHAFHFHCISRWLRTRSVCPLDNLEWNFDRYGLQ NT seq 339 nt NT seq  +upstreamnt  +downstreamnt atggactccgaagtgcagcagagcgatgccttcgatgacggtgtcaccggtggcggccca ccttcgaagcgctttattttaaagaagtggcatggtgtggctctctgggaatgggatatt gttgttgacaactgtgccatttgccgcaatcatgttatggatccgtgtattgagtgccag gccaatcactacgctgacaacggcaacgactgcgtcgtcgcctggggctcctgcagtcat gctttccatttccactgcatttcgcgttggctgcggacgcgttccgtctgtccactggat aatctagagtggaactttgacagatatggattgcagtaa

DBGET integrated database retrieval system