Drosophila grimshawi: 6562654 Help Entry 6562654           CDS       T01061                                  Name (RefSeq) RING-box protein 1   KO K03868   E3 ubiquitin-protein ligase RBX1 [EC:2.3.2.32] Organism dgr  Drosophila grimshawi Pathway dgr03420   Nucleotide excision repair dgr04120   Ubiquitin mediated proteolysis dgr04141   Protein processing in endoplasmic reticulum dgr04310   Wnt signaling pathway dgr04341   Hedgehog signaling pathway - fly dgr04350   TGF-beta signaling pathway Brite KEGG Orthology (KO) [BR:dgr00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     6562654    04120 Ubiquitin mediated proteolysis     6562654   09124 Replication and repair    03420 Nucleotide excision repair     6562654  09130 Environmental Information Processing   09132 Signal transduction    04310 Wnt signaling pathway     6562654    04341 Hedgehog signaling pathway - fly     6562654    04350 TGF-beta signaling pathway     6562654  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:dgr04121]     6562654    03400 DNA repair and recombination proteins [BR:dgr03400]     6562654 Enzymes [BR:dgr01000]  2. Transferases   2.3  Acyltransferases    2.3.2  Aminoacyltransferases     2.3.2.32  cullin-RING-type E3 NEDD8 transferase      6562654 Ubiquitin system [BR:dgr04121]  Ubiquitin ligases (E3)   UBL E3 ligases    6562654   Multi subunit type E3    SCF complex     Ring finger protein      6562654    Cul2 complex      6562654    Cul3 complex      6562654    Cul4 complex      6562654    Cul7 complex      6562654    Cul8 complex      6562654    Cul9 complex      6562654 DNA repair and recombination proteins [BR:dgr03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     GGR (global genome repair) factors      Cul4-DDB2 complex       6562654     TCR (transcription coupled repair) factors      Cul4-CSA complex       6562654 BRITE hierarchy SSDB OrthologParalogGFIT Other DBs NCBI-GeneID:  6562654 NCBI-ProteinID:  XP_001989385 UniProt:  B4JD08 LinkDB All DBs Position Unknown AA seq 159 aa AA seqDB search MEDTSESSSSAFHTAETENSEDPTTSQNAPTASKCESSQVELEMDRDENVKMDVEEKPAC SADYERSLKKKRFTVKRWNSVAMWAWDIAVDTCAICRNSIMDLCIECQADPNQNDFGECT VAWGVCNHAYHFHCISRWLKFRSVCPLDNREWEFQKLGR NT seq 480 nt NT seq  +upstreamnt  +downstreamnt atggaggacaccagtgaatcgagtagttctgcattccacacagccgagacggagaacagc gaggatccgaccacgtctcagaatgcgccaacagcgagcaagtgcgaaagctcgcaggtt gaactggagatggatagggatgagaatgtgaagatggatgtggaggagaagccagcctgc agcgctgactatgagaggagcctgaagaagaagcgatttacggtcaagcgatggaacagc gttgccatgtgggcctgggacattgctgtggacacttgtgcgatttgtcgaaattccatc atggatctgtgcatcgagtgccaggcggatccgaatcagaacgacttcggggagtgcacc gttgcctggggcgtctgcaatcacgcctatcacttccattgcatttcacgctggctgaag ttccgatccgtttgtccgctggacaatcgcgaatgggagttccagaagctgggacgttaa

DBGET integrated database retrieval system