Drosophila grimshawi: 6569282 Help Entry 6569282           CDS       T01061                                  Name (RefSeq) RING-box protein 1A   KO K03868   E3 ubiquitin-protein ligase RBX1 [EC:2.3.2.32] Organism dgr  Drosophila grimshawi Pathway dgr03420   Nucleotide excision repair dgr04120   Ubiquitin mediated proteolysis dgr04141   Protein processing in endoplasmic reticulum dgr04310   Wnt signaling pathway dgr04341   Hedgehog signaling pathway - fly dgr04350   TGF-beta signaling pathway Brite KEGG Orthology (KO) [BR:dgr00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     6569282    04120 Ubiquitin mediated proteolysis     6569282   09124 Replication and repair    03420 Nucleotide excision repair     6569282  09130 Environmental Information Processing   09132 Signal transduction    04310 Wnt signaling pathway     6569282    04341 Hedgehog signaling pathway - fly     6569282    04350 TGF-beta signaling pathway     6569282  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:dgr04121]     6569282    03400 DNA repair and recombination proteins [BR:dgr03400]     6569282 Enzymes [BR:dgr01000]  2. Transferases   2.3  Acyltransferases    2.3.2  Aminoacyltransferases     2.3.2.32  cullin-RING-type E3 NEDD8 transferase      6569282 Ubiquitin system [BR:dgr04121]  Ubiquitin ligases (E3)   UBL E3 ligases    6569282   Multi subunit type E3    SCF complex     Ring finger protein      6569282    Cul2 complex      6569282    Cul3 complex      6569282    Cul4 complex      6569282    Cul7 complex      6569282    Cul8 complex      6569282    Cul9 complex      6569282 DNA repair and recombination proteins [BR:dgr03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     GGR (global genome repair) factors      Cul4-DDB2 complex       6569282     TCR (transcription coupled repair) factors      Cul4-CSA complex       6569282 BRITE hierarchy SSDB OrthologParalogGFIT Other DBs NCBI-GeneID:  6569282 NCBI-ProteinID:  XP_001995546 UniProt:  B4JWS2 LinkDB All DBs Position Unknown AA seq 108 aa AA seqDB search MEVDEEEFEVPSSSSKGEKKRFEVKKWNAVALWAWDIVVDNCAICRNHIMDLCIECQANQ ASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNREWDFQKYGH NT seq 327 nt NT seq  +upstreamnt  +downstreamnt atggaggtcgatgaggaagagtttgaggttccgtccagcagcagcaagggcgagaagaaa cgtttcgaagtcaaaaagtggaatgcggtggcgctctgggcctgggatatcgttgtggat aactgcgctatttgccggaatcatataatggacctgtgcattgagtgccaagccaaccag gcatcggctactagcgaggagtgcaccgttgcttggggcgtttgcaatcatgcctttcat ttccattgcatatcgcgttggctaaagacgcgccaggtgtgcccactagataatcgtgaa tgggacttccagaagtatggccactaa

DBGET integrated database retrieval system