KEGG   Desulfitobacterium hafniense DCB-2: Dhaf_4327
Entry
Dhaf_4327         CDS       T00822                                 
Name
(GenBank) Tetrahydromethanopterin S-methyltransferase
  KO
K25221  [methyl-Co(III) glycine betaine-specific corrinoid protein]---tetrahydrofolate methyltransferase [EC:2.1.1.378]
Organism
dhd  Desulfitobacterium hafniense DCB-2
Pathway
dhd00670  One carbon pool by folate
dhd01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dhd00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    Dhaf_4327
Enzymes [BR:dhd01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.378  [methyl-Co(III) glycine betaine-specific corrinoid protein]---tetrahydrofolate methyltransferase
     Dhaf_4327
SSDB
Motif
Pfam: MtrH CobD_Cbib DUF3306
Other DBs
NCBI-ProteinID: ACL22332
UniProt: B8FUR2
Structure
LinkDB
Position
complement(4590980..4591900)
AA seq 306 aa
MFKFTAQQHVYDINGVKVGGQPGEYPTVLIGSIFYRGHKIVSDGQKGIFDKDAAKALLDQ
EAELSAETGNPFIIDVLGESVEALTKYVEFILENTTAPFLLDSISPDVRVGALKNLGKDP
EIQKRLIYNSIEEHYTEEELAAIKEAGLKTAVILAFSKKALKPNARIDLLQGKDDKEGLI
AAAKRAGIEQFLVDPGVLDVASNSWTTEAINVVKEQFGYPGGCAPSNAVYLWKKMRSKGT
PFFEVAGAAVFTYPITQGADFILYGPMMNAPWVYRAIATTDAMIAYNNKLTGVKMGTTEH
PLLKIF
NT seq 921 nt   +upstreamnt  +downstreamnt
atgttcaaatttactgctcaacaacatgtttatgacatcaatggggttaaggttggtggt
cagcctggggaatacccaacagtgctcatcggcagcattttttatcggggccataagatc
gtctcagatggtcaaaagggaattttcgacaaagatgcagccaaagctttgctggatcag
gaagccgaactaagcgcagaaacaggcaatccatttatcattgatgtcttgggagaatct
gttgaagcccttacgaaatacgtggaatttattttggaaaataccactgccccattcctc
ctggatagtatcagcccggatgtgcgggtaggagccctgaaaaatttgggcaaggatccg
gagattcagaaacggctgatctacaattccattgaagagcattacaccgaagaagagctg
gccgccatcaaagaggcagggctgaagaccgccgttatccttgctttcagtaagaaagcg
ttaaagcccaatgcccgcatcgatcttctccagggcaaggatgataaagaagggttgatt
gcagcggccaaacgggccggtatcgagcaattccttgtggatccgggagtcttggatgtg
gccagcaatagctggacgacggaagcgatcaatgtggttaaagagcaattcggctatccc
ggtggctgtgcgccatccaatgcagtctatctctggaagaaaatgcgttccaaaggaacc
cccttcttcgaagttgccggggctgcggtcttcacttatccgatcacacagggtgccgat
ttcattctctatggtcccatgatgaacgctccctgggtttatcgtgctatagcaaccaca
gatgccatgattgcctataacaataagctgaccggagttaagatgggaaccacagagcat
cctttgctcaaaattttctaa

DBGET integrated database retrieval system