Drosophila hydei: 111601088 Help Entry 111601088         CDS       T05888                                  Name (RefSeq) RING-box protein 1B   KO K03868   E3 ubiquitin-protein ligase RBX1 [EC:2.3.2.32] Organism dhe  Drosophila hydei Pathway dhe03420   Nucleotide excision repair dhe04120   Ubiquitin mediated proteolysis dhe04141   Protein processing in endoplasmic reticulum dhe04310   Wnt signaling pathway dhe04341   Hedgehog signaling pathway - fly dhe04350   TGF-beta signaling pathway Brite KEGG Orthology (KO) [BR:dhe00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     111601088    04120 Ubiquitin mediated proteolysis     111601088   09124 Replication and repair    03420 Nucleotide excision repair     111601088  09130 Environmental Information Processing   09132 Signal transduction    04310 Wnt signaling pathway     111601088    04341 Hedgehog signaling pathway - fly     111601088    04350 TGF-beta signaling pathway     111601088  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:dhe04121]     111601088    03400 DNA repair and recombination proteins [BR:dhe03400]     111601088 Enzymes [BR:dhe01000]  2. Transferases   2.3  Acyltransferases    2.3.2  Aminoacyltransferases     2.3.2.32  cullin-RING-type E3 NEDD8 transferase      111601088 Ubiquitin system [BR:dhe04121]  Ubiquitin ligases (E3)   UBL E3 ligases    111601088   Multi subunit type E3    SCF complex     Ring finger protein      111601088    Cul2 complex      111601088    Cul3 complex      111601088    Cul4 complex      111601088    Cul7 complex      111601088    Cul8 complex      111601088    Cul9 complex      111601088 DNA repair and recombination proteins [BR:dhe03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     GGR (global genome repair) factors      Cul4-DDB2 complex       111601088     TCR (transcription coupled repair) factors      Cul4-CSA complex       111601088 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  zf-rbx1 zf-ANAPC11 zf-RING_2 zf-C3HC4_2 zf-C3HC4 zf-RING_11 zf-RING_UBOX Motif Other DBs NCBI-GeneID:  111601088 NCBI-ProteinID:  XP_023173283 UniProt:  A0A6J1LY42 LinkDB All DBs Position Unknown AA seq 129 aa AA seqDB search METCNKNGSMAEELEVEETEDFHDLDEFNEDNVASGSGKKDERFVVKKWVAHAHWSWDVA VDNCAICRNHIMNLCIECQADPNANKDECTVAWGECNHAFHYHCIARWLKTRHVCPLDNK EWVYQKYGH NT seq 390 nt NT seq  +upstreamnt  +downstreamnt atggaaacctgtaacaaaaatggatccatggccgaggagctcgaggtggaggaaacggaa gatttccacgatctggacgagttcaacgaagacaacgtggctagtggcagcggaaagaaa gacgaacgtttcgtagtcaagaagtgggtggcccatgcgcattggtcctgggatgtggct gtggacaactgcgccatttgccgaaatcacattatgaatctgtgcattgagtgccaggcg gatccgaatgcgaataaggatgagtgcactgtggcatggggtgagtgcaatcatgcgttc cactatcactgcattgcccgttggctcaagactcgccacgtctgcccgctggacaacaag gagtgggtctaccaaaaatatggccactag

DBGET integrated database retrieval system