KEGG   Dissulfurimicrobium hydrothermale: LGS26_04895
Entry
LGS26_04895       CDS       T07882                                 
Symbol
fabG
Name
(GenBank) 3-oxoacyl-[acyl-carrier-protein] reductase
  KO
K00059  3-oxoacyl-[acyl-carrier protein] reductase [EC:1.1.1.100]
Organism
dhr  Dissulfurimicrobium hydrothermale
Pathway
dhr00061  Fatty acid biosynthesis
dhr00780  Biotin metabolism
dhr01100  Metabolic pathways
dhr01110  Biosynthesis of secondary metabolites
dhr01212  Fatty acid metabolism
dhr01240  Biosynthesis of cofactors
Brite
KEGG Orthology (KO) [BR:dhr00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    LGS26_04895 (fabG)
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    LGS26_04895 (fabG)
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    LGS26_04895 (fabG)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:dhr01004]
    LGS26_04895 (fabG)
Enzymes [BR:dhr01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.100  3-oxoacyl-[acyl-carrier-protein] reductase
     LGS26_04895 (fabG)
Lipid biosynthesis proteins [BR:dhr01004]
 Fatty acid synthase
  Component type
   LGS26_04895 (fabG)
SSDB
Motif
Pfam: adh_short_C2 adh_short KR SDR Epimerase Polysacc_synt_2
Other DBs
NCBI-ProteinID: UKL14566
LinkDB
Position
1007121..1007879
AA seq 252 aa
MGCEQILKDKIALVTGGSRGIGRAICLKLASLGARVFINYANNEAAARTVMDEITRSGGR
ASLLPFDVSDRGAASDSIKRLISDAGALHILVNNAGIARDNLAVRMKQEDWDSVISINLT
GAFNCIQSALTAMMKQRWGRIVNIGSVVGTMGNAGQANYAAAKAGLEGLTRSIALEVASR
GITANVVSPGFIDTDMTAGLSDKIREQLLAHIPMGRMGRVEDVAEAVAFLSSDGASYITG
HVLHVNGGLFCD
NT seq 759 nt   +upstreamnt  +downstreamnt
atgggttgtgaacagatattgaaggataagattgccctggtcacaggcggttcaaggggt
ataggtcgggccatctgccttaaactggctagtctgggtgcgcgtgtttttataaattat
gcaaataatgaggcggcggcaaggactgtaatggatgaaataacacgttcaggtggccgt
gcatctctgctgccatttgatgtatccgacagaggcgccgcgtcagattccataaagaga
ttgatatcagatgccggtgcgcttcatatactggtcaacaatgctggcatagcgagagac
aatcttgccgtgcggatgaagcaagaggattgggatagcgtcatatccataaacctgaca
ggcgccttcaactgcatccagtctgccctaacggccatgatgaagcagagatgggggcgt
attgtaaatataggttctgtagtgggtaccatggggaacgcaggccaggctaattacgcg
gctgcaaaggccgggcttgagggtcttacgagatctatagcgcttgaggtggcgtcaagg
ggtatcacggccaatgtggtgtcacctggttttatagataccgacatgaccgcagggttg
tcggataagatccgagagcagttgctcgcgcatatacccatgggtaggatgggtagagtt
gaagatgtggccgaggcggtggcctttctttcctccgatggggcttcatatatcacaggt
catgtgttgcatgtaaacggaggattgttctgcgactaa

DBGET integrated database retrieval system