Diaphorobacter sp. HDW4A: G7047_21095 Help Entry G7047_21095       CDS       T06499                                  Name (GenBank) acyl carrier protein   KO K14188   D-alanine--poly(phosphoribitol) ligase subunit 2 [EC:6.1.1.13] Organism dih  Diaphorobacter sp. HDW4A Pathway dih00470   D-Amino acid metabolism dih00552   Teichoic acid biosynthesis dih01100   Metabolic pathways dih01503   Cationic antimicrobial peptide (CAMP) resistance dih02020   Two-component system Brite KEGG Orthology (KO) [BR:dih00001]  09100 Metabolism   09106 Metabolism of other amino acids    00470 D-Amino acid metabolism     G7047_21095   09107 Glycan biosynthesis and metabolism    00552 Teichoic acid biosynthesis     G7047_21095  09130 Environmental Information Processing   09132 Signal transduction    02020 Two-component system     G7047_21095  09160 Human Diseases   09175 Drug resistance: antimicrobial    01503 Cationic antimicrobial peptide (CAMP) resistance     G7047_21095  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    01504 Antimicrobial resistance genes [BR:dih01504]     G7047_21095 Enzymes [BR:dih01000]  6. Ligases   6.1  Forming carbon-oxygen bonds    6.1.1  Ligases forming aminoacyl-tRNA and related compounds     6.1.1.13  D-alanine---poly(phosphoribitol) ligase      G7047_21095 Antimicrobial resistance genes [BR:dih01504]  Gene sets   CAMP resistance modules    Cationic antimicrobial peptide (CAMP) resistance, dltABCD operon [MD:M00725]     G7047_21095 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7215 DUF7080 Motif Other DBs NCBI-ProteinID:  QIL82147 UniProt:  A0A6G8CTV8 LinkDB All DBs Position 4601142..4601381 Genome browser AA seq 79 aa AA seqDB search MSMNEIESRAASLIEGIIMTPVDAETQLIDSGLVDSLSAVDVTLAVEREFGVKIPPSEID VHLQSVQTLAQFIQARVHA NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atgagcatgaacgaaattgaatcccgcgccgcatcgctgatcgaaggaatcatcatgacg cccgtcgatgccgagacccagctgatcgattcagggctggtcgattcgctgtccgctgtc gatgtcacgctcgccgtcgagcgcgagttcggcgtgaagattcccccctcggaaatcgac gtgcacctgcaatcggtgcagacgcttgcgcaattcatccaggcgcgtgtgcatgcctga

DBGET integrated database retrieval system