Dickeya lacustris: O1Q98_14440 Help Entry O1Q98_14440       CDS       T08984                                  Symbol folA Name (GenBank) type 3 dihydrofolate reductase   KO K00287   dihydrofolate reductase [EC:1.5.1.3] Organism dlc  Dickeya lacustris Pathway dlc00670   One carbon pool by folate dlc00790   Folate biosynthesis dlc01100   Metabolic pathways dlc01240   Biosynthesis of cofactors dlc04981   Folate transport and metabolism Module dlc_M00126   Tetrahydrofolate biosynthesis, GTP => THF Brite KEGG Orthology (KO) [BR:dlc00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00790 Folate biosynthesis     O1Q98_14440 (folA)    00670 One carbon pool by folate     O1Q98_14440 (folA)  09150 Organismal Systems   09154 Digestive system    04981 Folate transport and metabolism     O1Q98_14440 (folA) Enzymes [BR:dlc01000]  1. Oxidoreductases   1.5  Acting on the CH-NH group of donors    1.5.1  With NAD+ or NADP+ as acceptor     1.5.1.3  dihydrofolate reductase      O1Q98_14440 (folA) SSDB OrthologParalogGFIT Motif Pfam:  DHFR_1 Motif Other DBs NCBI-ProteinID:  WFN54842 UniProt:  A0ABY8G4G7 LinkDB All DBs Position 3176582..3177064 Genome browser AA seq 160 aa AA seqDB search MVISLIAALAVDRVIGMENAMPWHLPADLAWFKRNTLNKPVIMGRKTYQSIGKPLPGRLN IVVSRQPGDDDRVTWADSLEAALAAAGEVEEVMVIGGGHVYQQMLPRATRLYLTHIDAEV EGDTHFPDYEPDEWVSSFSEFHDADEHNSHCYCFEILERR NT seq 483 nt NT seq  +upstreamnt  +downstreamnt atggtgattagtttgattgccgcactggcagtagatcgtgtgatcggtatggaaaatgcc atgccgtggcatttgcccgccgatttagcgtggtttaagcgcaacaccctcaataagccc gttatcatggggcgcaagacataccagtctatcggcaagccgctgcctggccggttgaac attgtggtgagtcgccagcccggcgatgacgatcgcgtcacttgggcggattcgctggag gctgcgctggccgccgccggagaggttgaggaagtcatggtgatcggcggcggtcatgtg tatcagcagatgttgccgcgtgccacccggctttatctgactcacattgatgctgaagtc gaaggcgatacccatttcccggactatgagccggatgagtgggtatcaagcttcagcgaa ttccacgatgccgatgaacacaactcgcactgctactgtttcgagattcttgaacgtcgc tag

DBGET integrated database retrieval system