Delphinapterus leucas (beluga whale): 111166066
Help
Entry
111166066 CDS
T05885
Symbol
GNA11
Name
(RefSeq) guanine nucleotide-binding protein subunit alpha-11
KO
K04635
guanine nucleotide-binding protein subunit alpha-11
Organism
dle
Delphinapterus leucas (beluga whale)
Pathway
dle04020
Calcium signaling pathway
dle04022
cGMP-PKG signaling pathway
dle04081
Hormone signaling
dle04082
Neuroactive ligand signaling
dle04270
Vascular smooth muscle contraction
dle04540
Gap junction
dle04725
Cholinergic synapse
dle04730
Long-term depression
dle04911
Insulin secretion
dle04912
GnRH signaling pathway
dle04925
Aldosterone synthesis and secretion
dle04927
Cortisol synthesis and secretion
dle04928
Parathyroid hormone synthesis, secretion and action
dle04929
GnRH secretion
dle04934
Cushing syndrome
dle04935
Growth hormone synthesis, secretion and action
dle05142
Chagas disease
dle05146
Amoebiasis
dle05163
Human cytomegalovirus infection
dle05170
Human immunodeficiency virus 1 infection
dle05200
Pathways in cancer
Brite
KEGG Orthology (KO) [BR:
dle00001
]
09130 Environmental Information Processing
09132 Signal transduction
04020 Calcium signaling pathway
111166066 (GNA11)
04022 cGMP-PKG signaling pathway
111166066 (GNA11)
09133 Signaling molecules and interaction
04082 Neuroactive ligand signaling
111166066 (GNA11)
04081 Hormone signaling
111166066 (GNA11)
09140 Cellular Processes
09144 Cellular community - eukaryotes
04540 Gap junction
111166066 (GNA11)
09150 Organismal Systems
09152 Endocrine system
04911 Insulin secretion
111166066 (GNA11)
04929 GnRH secretion
111166066 (GNA11)
04912 GnRH signaling pathway
111166066 (GNA11)
04935 Growth hormone synthesis, secretion and action
111166066 (GNA11)
04928 Parathyroid hormone synthesis, secretion and action
111166066 (GNA11)
04925 Aldosterone synthesis and secretion
111166066 (GNA11)
04927 Cortisol synthesis and secretion
111166066 (GNA11)
09153 Circulatory system
04270 Vascular smooth muscle contraction
111166066 (GNA11)
09156 Nervous system
04725 Cholinergic synapse
111166066 (GNA11)
04730 Long-term depression
111166066 (GNA11)
09160 Human Diseases
09161 Cancer: overview
05200 Pathways in cancer
111166066 (GNA11)
09172 Infectious disease: viral
05170 Human immunodeficiency virus 1 infection
111166066 (GNA11)
05163 Human cytomegalovirus infection
111166066 (GNA11)
09174 Infectious disease: parasitic
05146 Amoebiasis
111166066 (GNA11)
05142 Chagas disease
111166066 (GNA11)
09167 Endocrine and metabolic disease
04934 Cushing syndrome
111166066 (GNA11)
09180 Brite Hierarchies
09183 Protein families: signaling and cellular processes
04147 Exosome [BR:
dle04147
]
111166066 (GNA11)
04031 GTP-binding proteins [BR:
dle04031
]
111166066 (GNA11)
Exosome [BR:
dle04147
]
Exosomal proteins
Exosomal proteins of other body fluids (saliva and urine)
111166066 (GNA11)
Exosomal proteins of melanoma cells
111166066 (GNA11)
GTP-binding proteins [BR:
dle04031
]
Heterotrimeric G-proteins
Alpha Subunits
Alpha type 3 (Gq/11) [OT]
111166066 (GNA11)
BRITE hierarchy
SSDB
Ortholog
Paralog
GFIT
Motif
Pfam:
G-alpha
Arf
DUF2194
Gtr1_RagA
FtsK_SpoIIIE
AAA_29
Motif
Other DBs
NCBI-GeneID:
111166066
NCBI-ProteinID:
XP_022413036
UniProt:
A0A2Y9LWA4
LinkDB
All DBs
Position
Unknown
AA seq
359 aa
AA seq
DB search
MTLESMMACCLSDEVKESKRINAEIEKQLRRDKRDARRELKLLLLGTGESGKSTFIKQMR
IIHGAGYSEEDKRGFTKLVYQNIFTAMQAMIRAMETLKILYKYEQNKANALLIREVDVEK
VTTFEHRYVSAIKTLWNDPGIQECYDRRREYQLSDSAKYYLTDVDRIAASGYLPTQQDVL
RVRVPTTGIIEYPFDLENIIFRMVDVGGQRSERRKWIHCFENVTSIMFLVALSEYDQVLV
ESDNENRMEESKALFRTIVTYPWFQNSSVILFLNKKDLLEDKILHSHLVDYFPEFDGPQR
DAQAAREFILKMFVDLNPDSDKIIYSHFTCATDTENIRFVFAAVKDTILQLNLKEYNLV
NT seq
1080 nt
NT seq
+upstream
nt +downstream
nt
atgactctggagtccatgatggcgtgttgcctgagcgatgaggtgaaggagtccaagcgg
atcaacgccgagatcgagaaacagctgcggcgggacaagcgcgacgcccggcgcgagctc
aagctactgctgctcggcacgggcgagagcgggaagagcactttcatcaagcagatgcgc
atcatccacggggcgggctactcggaggaggacaagcggggcttcaccaagctggtgtac
cagaacatcttcaccgccatgcaggccatgatccgggccatggagaccctgaagatcctc
tacaagtacgagcagaacaaggccaacgcgctcctgatccgggaggtggatgtggagaag
gtgaccaccttcgagcaccggtacgtgagtgccatcaagaccctgtggaacgaccccggc
atccaggagtgctacgaccgccggcgggagtaccagctctcggactctgccaagtactac
ctgactgacgtggaccgcatcgccgcctcgggctacctgcccacgcagcaggacgtgctg
cgagtccgcgtgcccaccaccggcatcatcgagtaccccttcgacctggagaacatcatt
ttcaggatggtggacgtggggggccagaggtccgagcggagaaagtggatccactgcttt
gagaacgtgacgtccatcatgttcctcgtggccctcagcgagtacgaccaagtgctggtg
gagtcggacaacgagaaccgcatggaggagagcaaagcactgttccggaccatcgtcacc
tacccctggttccagaactcgtctgtcatcctcttcctcaacaagaaggacctgctggag
gacaagatcctccactcccacctggtggactacttccccgagttcgacggcccgcagcgg
gacgcgcaggccgcccgggagttcatcctgaagatgttcgtggacctgaaccccgacagc
gacaagatcatctattcccacttcacgtgtgccaccgacacggagaacatccgcttcgtc
ttcgccgctgtcaaggacaccatcctgcagctcaacctgaaggagtacaacctggtgtga
DBGET
integrated database retrieval system