Delphinapterus leucas (beluga whale): 111173766 Help Entry 111173766         CDS       T05885                                  Symbol RAP1B Name (RefSeq) ras-related protein Rap-1b   KO K07836   Ras-related protein Rap-1B Organism dle  Delphinapterus leucas (beluga whale) Pathway dle04010   MAPK signaling pathway dle04014   Ras signaling pathway dle04015   Rap1 signaling pathway dle04024   cAMP signaling pathway dle04062   Chemokine signaling pathway dle04510   Focal adhesion dle04520   Adherens junction dle04611   Platelet activation dle04670   Leukocyte transendothelial migration dle04720   Long-term potentiation dle04722   Neurotrophin signaling pathway dle04934   Cushing syndrome dle04972   Pancreatic secretion dle05211   Renal cell carcinoma dle05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:dle00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     111173766 (RAP1B)    04014 Ras signaling pathway     111173766 (RAP1B)    04015 Rap1 signaling pathway     111173766 (RAP1B)    04024 cAMP signaling pathway     111173766 (RAP1B)  09140 Cellular Processes   09144 Cellular community - eukaryotes    04510 Focal adhesion     111173766 (RAP1B)    04520 Adherens junction     111173766 (RAP1B)  09150 Organismal Systems   09151 Immune system    04611 Platelet activation     111173766 (RAP1B)    04670 Leukocyte transendothelial migration     111173766 (RAP1B)    04062 Chemokine signaling pathway     111173766 (RAP1B)   09154 Digestive system    04972 Pancreatic secretion     111173766 (RAP1B)   09156 Nervous system    04720 Long-term potentiation     111173766 (RAP1B)    04722 Neurotrophin signaling pathway     111173766 (RAP1B)  09160 Human Diseases   09162 Cancer: specific types    05211 Renal cell carcinoma     111173766 (RAP1B)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     111173766 (RAP1B)   09167 Endocrine and metabolic disease    04934 Cushing syndrome     111173766 (RAP1B)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:dle04147]     111173766 (RAP1B)    04031 GTP-binding proteins [BR:dle04031]     111173766 (RAP1B) Exosome [BR:dle04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    111173766 (RAP1B)   Exosomal proteins of other body fluids (saliva and urine)    111173766 (RAP1B)   Exosomal proteins of colorectal cancer cells    111173766 (RAP1B) GTP-binding proteins [BR:dle04031]  Small (monomeric) G-proteins   Ras Family    Rap [OT]     111173766 (RAP1B) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 G-alpha Motif Other DBs NCBI-GeneID:  111173766 NCBI-ProteinID:  XP_022427297 UniProt:  A0A2Y9NDH8 LinkDB All DBs Position Unknown AA seq 184 aa AA seqDB search MREYKLVVLGSGGVGKSALTVQFVQGIFVEKYDPTIEDSYRKQVEVDAQQCMLEILDTAG TEQFTAMRDLYMKNGQGFALVYSITAQSTFNDLQDLREQILRVKDTDDVPMILVGNKCDL EDERVVGKEQGQNLARQWNNCAFLESSAKSKINVNEIFYDLVRQINRKTPVPGKARKKSS CQLL NT seq 555 nt NT seq  +upstreamnt  +downstreamnt atgcgtgagtataagctagtcgttcttggctctggaggagttggaaaatctgctctgact gtacaatttgttcaaggaatttttgttgaaaaatatgatcctacgatagaagattcttat agaaagcaagttgaagtagatgcacaacagtgtatgcttgaaatcttggatactgcagga acggaacaatttacagcaatgagggatttgtacatgaaaaacggacaaggctttgcatta gtttattccatcacagcacagtccacatttaatgatttacaagatctgagagaacagatt cttcgagttaaagacactgatgatgttccaatgattctggttggtaataagtgtgacttg gaagatgaaagagttgtaggaaaggaacaaggtcaaaatttagcaagacaatggaacaac tgtgcattcttagaatcctctgcaaaatcaaaaataaatgttaatgagatcttttatgac ctagtgcggcaaattaacagaaaaactccagtgcctgggaaggcccgcaaaaagtcgtca tgtcagctgctttaa

DBGET integrated database retrieval system