Delphinapterus leucas (beluga whale): 111174560 Help Entry 111174560         CDS       T05885                                  Symbol IFNB1 Name (RefSeq) interferon beta   KO K05415   interferon beta Organism dle  Delphinapterus leucas (beluga whale) Pathway dle04060   Cytokine-cytokine receptor interaction dle04151   PI3K-Akt signaling pathway dle04217   Necroptosis dle04380   Osteoclast differentiation dle04620   Toll-like receptor signaling pathway dle04621   NOD-like receptor signaling pathway dle04622   RIG-I-like receptor signaling pathway dle04623   Cytosolic DNA-sensing pathway dle04630   JAK-STAT signaling pathway dle04650   Natural killer cell mediated cytotoxicity dle04668   TNF signaling pathway dle04936   Alcoholic liver disease dle05135   Yersinia infection dle05142   Chagas disease dle05152   Tuberculosis dle05160   Hepatitis C dle05161   Hepatitis B dle05162   Measles dle05163   Human cytomegalovirus infection dle05164   Influenza A dle05165   Human papillomavirus infection dle05167   Kaposi sarcoma-associated herpesvirus infection dle05168   Herpes simplex virus 1 infection dle05169   Epstein-Barr virus infection dle05170   Human immunodeficiency virus 1 infection dle05171   Coronavirus disease - COVID-19 dle05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:dle00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     111174560 (IFNB1)    04668 TNF signaling pathway     111174560 (IFNB1)    04151 PI3K-Akt signaling pathway     111174560 (IFNB1)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     111174560 (IFNB1)  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     111174560 (IFNB1)  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     111174560 (IFNB1)    04621 NOD-like receptor signaling pathway     111174560 (IFNB1)    04622 RIG-I-like receptor signaling pathway     111174560 (IFNB1)    04623 Cytosolic DNA-sensing pathway     111174560 (IFNB1)    04650 Natural killer cell mediated cytotoxicity     111174560 (IFNB1)   09158 Development and regeneration    04380 Osteoclast differentiation     111174560 (IFNB1)  09160 Human Diseases   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     111174560 (IFNB1)    05161 Hepatitis B     111174560 (IFNB1)    05160 Hepatitis C     111174560 (IFNB1)    05171 Coronavirus disease - COVID-19     111174560 (IFNB1)    05164 Influenza A     111174560 (IFNB1)    05162 Measles     111174560 (IFNB1)    05168 Herpes simplex virus 1 infection     111174560 (IFNB1)    05163 Human cytomegalovirus infection     111174560 (IFNB1)    05167 Kaposi sarcoma-associated herpesvirus infection     111174560 (IFNB1)    05169 Epstein-Barr virus infection     111174560 (IFNB1)    05165 Human papillomavirus infection     111174560 (IFNB1)   09171 Infectious disease: bacterial    05135 Yersinia infection     111174560 (IFNB1)    05152 Tuberculosis     111174560 (IFNB1)   09174 Infectious disease: parasitic    05142 Chagas disease     111174560 (IFNB1)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     111174560 (IFNB1)   09167 Endocrine and metabolic disease    04936 Alcoholic liver disease     111174560 (IFNB1)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:dle04052]     111174560 (IFNB1) Cytokines and neuropeptides [BR:dle04052]  Cytokines   Interferons    111174560 (IFNB1) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Interferon Nudc_N SesA Motif Other DBs NCBI-GeneID:  111174560 NCBI-ProteinID:  XP_022429154 UniProt:  A0A2Y9N397 LinkDB All DBs Position Unknown AA seq 185 aa AA seqDB search MTHRCILQIALLLCFSTTALSTSYRLLQFQQRSSNLACQKLLQQLPGMPQHCLEDRMDFK VPEEIKQPQQFQKEDAVLVIYEMLQQIFGILRRNFSSTGWTKTITENLLVEVYGQMDRLE NILEEIMEKENFTRGVNILHLKKYYLQIVQYLKSKEYSNCAWTVVRVEILRNFSFLNRLT DYLHN NT seq 558 nt NT seq  +upstreamnt  +downstreamnt atgacccacaggtgcatcctccaaatcgctctcctgttgtgcttctccaccacagctctt tccacgagctacagattgcttcaattccaacaaaggagcagcaatttggcgtgtcagaaa ctcctgcagcagttacctggaatgcctcaacattgcctcgaggacaggatggacttcaag gtccctgaggagattaagcaaccacagcagttccagaaggaagacgccgtattggtcatc tatgagatgctccagcagatctttggtattctcagaagaaatttctctagcaccggctgg actaagaccatcactgagaacctccttgtggaagtctatgggcagatggatcgtctggag aatatcctggaggaaataatggagaaggaaaacttcaccaggggagtgaacattcttcac ctgaagaaatactacttgcagatcgtgcagtacctgaagtccaaggagtacagcaactgt gcctggacagtagtgcgagtggaaatcctcaggaacttttccttccttaaccgccttaca gattacctccataattga

DBGET integrated database retrieval system