Delphinapterus leucas (beluga whale): 111176238 Help Entry 111176238         CDS       T05885                                  Symbol FOS Name (RefSeq) proto-oncogene c-Fos   KO K04379   proto-oncogene protein c-fos Organism dle  Delphinapterus leucas (beluga whale) Pathway dle01522   Endocrine resistance dle04010   MAPK signaling pathway dle04024   cAMP signaling pathway dle04210   Apoptosis dle04380   Osteoclast differentiation dle04620   Toll-like receptor signaling pathway dle04657   IL-17 signaling pathway dle04658   Th1 and Th2 cell differentiation dle04659   Th17 cell differentiation dle04660   T cell receptor signaling pathway dle04662   B cell receptor signaling pathway dle04668   TNF signaling pathway dle04713   Circadian entrainment dle04725   Cholinergic synapse dle04728   Dopaminergic synapse dle04915   Estrogen signaling pathway dle04917   Prolactin signaling pathway dle04921   Oxytocin signaling pathway dle04926   Relaxin signaling pathway dle04928   Parathyroid hormone synthesis, secretion and action dle04932   Non-alcoholic fatty liver disease dle04935   Growth hormone synthesis, secretion and action dle05031   Amphetamine addiction dle05132   Salmonella infection dle05133   Pertussis dle05135   Yersinia infection dle05140   Leishmaniasis dle05142   Chagas disease dle05161   Hepatitis B dle05162   Measles dle05166   Human T-cell leukemia virus 1 infection dle05167   Kaposi sarcoma-associated herpesvirus infection dle05170   Human immunodeficiency virus 1 infection dle05171   Coronavirus disease - COVID-19 dle05200   Pathways in cancer dle05207   Chemical carcinogenesis - receptor activation dle05208   Chemical carcinogenesis - reactive oxygen species dle05210   Colorectal cancer dle05224   Breast cancer dle05231   Choline metabolism in cancer dle05235   PD-L1 expression and PD-1 checkpoint pathway in cancer dle05323   Rheumatoid arthritis dle05417   Lipid and atherosclerosis dle05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:dle00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     111176238 (FOS)    04668 TNF signaling pathway     111176238 (FOS)    04024 cAMP signaling pathway     111176238 (FOS)  09140 Cellular Processes   09143 Cell growth and death    04210 Apoptosis     111176238 (FOS)  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     111176238 (FOS)    04660 T cell receptor signaling pathway     111176238 (FOS)    04658 Th1 and Th2 cell differentiation     111176238 (FOS)    04659 Th17 cell differentiation     111176238 (FOS)    04657 IL-17 signaling pathway     111176238 (FOS)    04662 B cell receptor signaling pathway     111176238 (FOS)   09152 Endocrine system    04915 Estrogen signaling pathway     111176238 (FOS)    04917 Prolactin signaling pathway     111176238 (FOS)    04921 Oxytocin signaling pathway     111176238 (FOS)    04926 Relaxin signaling pathway     111176238 (FOS)    04935 Growth hormone synthesis, secretion and action     111176238 (FOS)    04928 Parathyroid hormone synthesis, secretion and action     111176238 (FOS)   09156 Nervous system    04725 Cholinergic synapse     111176238 (FOS)    04728 Dopaminergic synapse     111176238 (FOS)   09158 Development and regeneration    04380 Osteoclast differentiation     111176238 (FOS)   09159 Environmental adaptation    04713 Circadian entrainment     111176238 (FOS)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     111176238 (FOS)    05207 Chemical carcinogenesis - receptor activation     111176238 (FOS)    05208 Chemical carcinogenesis - reactive oxygen species     111176238 (FOS)    05231 Choline metabolism in cancer     111176238 (FOS)    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     111176238 (FOS)   09162 Cancer: specific types    05210 Colorectal cancer     111176238 (FOS)    05224 Breast cancer     111176238 (FOS)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     111176238 (FOS)    05170 Human immunodeficiency virus 1 infection     111176238 (FOS)    05161 Hepatitis B     111176238 (FOS)    05171 Coronavirus disease - COVID-19     111176238 (FOS)    05162 Measles     111176238 (FOS)    05167 Kaposi sarcoma-associated herpesvirus infection     111176238 (FOS)   09171 Infectious disease: bacterial    05132 Salmonella infection     111176238 (FOS)    05135 Yersinia infection     111176238 (FOS)    05133 Pertussis     111176238 (FOS)   09174 Infectious disease: parasitic    05140 Leishmaniasis     111176238 (FOS)    05142 Chagas disease     111176238 (FOS)   09163 Immune disease    05323 Rheumatoid arthritis     111176238 (FOS)   09165 Substance dependence    05031 Amphetamine addiction     111176238 (FOS)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     111176238 (FOS)    05418 Fluid shear stress and atherosclerosis     111176238 (FOS)   09167 Endocrine and metabolic disease    04932 Non-alcoholic fatty liver disease     111176238 (FOS)   09176 Drug resistance: antineoplastic    01522 Endocrine resistance     111176238 (FOS)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03000 Transcription factors [BR:dle03000]     111176238 (FOS)    04131 Membrane trafficking [BR:dle04131]     111176238 (FOS) Transcription factors [BR:dle03000]  Eukaryotic type   Basic leucine zipper (bZIP)    AP-1(-like) components, Fos     111176238 (FOS) Membrane trafficking [BR:dle04131]  Autophagy   Chaperone mediated autophagy (CMA)    Selective cargos     111176238 (FOS) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  bZIP_1 bZIP_2 bZIP_Maf MIC19_MIC25 DUF3450 HALZ Macoilin Motif Other DBs NCBI-GeneID:  111176238 NCBI-ProteinID:  XP_022432226 UniProt:  A0A2Y9NGY2 LinkDB All DBs Position Unknown AA seq 380 aa AA seqDB search MMFSGFNADYEASSSRCSSASPAGDSLSYYHSPADSFSSMGSPVNAQDFCTDLAVSSANF IPTVTAISTSPDLQWLVQPTLVSSVAPSQTRAPHPYGVPTPSAGAYSRAGVMKTMTGGRA QSIGRRGKVEQLSPEEEEKRRIRRERNKMAAAKCRNRRRELTDTLQAETDQLEDEKSALQ TEIANLLKEKEKLEFILAAHRPACKIPDDMGFPEEMSVASLDLSGGLPEAATPESEEAFT LPLLNDPEPKPSVEPVKSISSMELKAEPFDDFLFPASSRPSGSETARSVPDMDLSGSFYA ADWEPLHGGSLGMGPMATELEPLCTPVVTCTPSCTTYTSSFVFTYPEADSFPSCAAAHRK GSSSNEPSSDSLSSPTLLAL NT seq 1143 nt NT seq  +upstreamnt  +downstreamnt atgatgttctctggcttcaacgccgactacgaggcgtcatcctcccgctgcagcagcgcc tccccggccggggacagcctctcctactaccactcaccggccgactccttctccagtatg ggctctcccgtcaatgcgcaggacttctgcaccgatctggccgtctccagtgccaacttc atcccaacagtgaccgccatctcgaccagcccggacctgcagtggctagtgcagcccacc ctggtctcctccgtggccccatcccagaccagagccccccacccctatggagtccccacc ccctcggctggggcttactccagggctggggtcatgaagaccatgaccggaggcagagct cagagcattggcaggaggggcaaggtagaacagttgtccccagaagaagaggagaaaagg agaatccgaagggaaaggaataagatggctgcagccaaatgccggaaccggaggagggag ctgactgacacactccaagcggaaacagaccaactagaagatgagaagtctgctttgcag actgagattgccaacctgctaaaggagaaggaaaaactagagttcatcctggcagctcac cgacctgcctgcaagatccctgatgacatgggcttcccagaagaaatgtctgtggcttcc cttgatctgagcgggggcctgcctgaagccgccaccccggaatctgaggaggccttcacc ctacccctccttaatgaccctgagcccaagccctcagtggagcccgtcaagagcatcagc agcatggagctgaaggctgagccctttgatgacttcctgttcccagcatcgtccaggccc agcggctctgagaccgcccgttctgtgccagacatggacctgtctggttccttctatgca gcagactgggagcccctgcatggtggctccctggggatggggcccatggccacagagctg gaacccctgtgcaccccggtggtcacctgtacacccagctgcactacttacacgtcttcc tttgtcttcacctaccctgaggctgactccttccccagctgtgcggctgcccaccgcaag ggcagcagcagcaacgagccctcctctgactcgctcagctcacccacgctgctggccctg tga

DBGET integrated database retrieval system