Delphinapterus leucas (beluga whale): 111181978 Help Entry 111181978         CDS       T05885                                  Symbol IL6 Name (RefSeq) interleukin-6   KO K05405   interleukin 6 Organism dle  Delphinapterus leucas (beluga whale) Pathway dle01521   EGFR tyrosine kinase inhibitor resistance dle01523   Antifolate resistance dle04060   Cytokine-cytokine receptor interaction dle04061   Viral protein interaction with cytokine and cytokine receptor dle04066   HIF-1 signaling pathway dle04068   FoxO signaling pathway dle04151   PI3K-Akt signaling pathway dle04218   Cellular senescence dle04620   Toll-like receptor signaling pathway dle04621   NOD-like receptor signaling pathway dle04623   Cytosolic DNA-sensing pathway dle04625   C-type lectin receptor signaling pathway dle04630   JAK-STAT signaling pathway dle04640   Hematopoietic cell lineage dle04657   IL-17 signaling pathway dle04659   Th17 cell differentiation dle04668   TNF signaling pathway dle04672   Intestinal immune network for IgA production dle04931   Insulin resistance dle04932   Non-alcoholic fatty liver disease dle04933   AGE-RAGE signaling pathway in diabetic complications dle04936   Alcoholic liver disease dle05010   Alzheimer disease dle05020   Prion disease dle05022   Pathways of neurodegeneration - multiple diseases dle05132   Salmonella infection dle05133   Pertussis dle05134   Legionellosis dle05135   Yersinia infection dle05142   Chagas disease dle05143   African trypanosomiasis dle05144   Malaria dle05146   Amoebiasis dle05152   Tuberculosis dle05161   Hepatitis B dle05162   Measles dle05163   Human cytomegalovirus infection dle05164   Influenza A dle05166   Human T-cell leukemia virus 1 infection dle05167   Kaposi sarcoma-associated herpesvirus infection dle05168   Herpes simplex virus 1 infection dle05169   Epstein-Barr virus infection dle05171   Coronavirus disease - COVID-19 dle05200   Pathways in cancer dle05202   Transcriptional misregulation in cancer dle05321   Inflammatory bowel disease dle05323   Rheumatoid arthritis dle05332   Graft-versus-host disease dle05410   Hypertrophic cardiomyopathy dle05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:dle00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     111181978 (IL6)    04668 TNF signaling pathway     111181978 (IL6)    04066 HIF-1 signaling pathway     111181978 (IL6)    04068 FoxO signaling pathway     111181978 (IL6)    04151 PI3K-Akt signaling pathway     111181978 (IL6)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     111181978 (IL6)    04061 Viral protein interaction with cytokine and cytokine receptor     111181978 (IL6)  09140 Cellular Processes   09143 Cell growth and death    04218 Cellular senescence     111181978 (IL6)  09150 Organismal Systems   09151 Immune system    04640 Hematopoietic cell lineage     111181978 (IL6)    04620 Toll-like receptor signaling pathway     111181978 (IL6)    04621 NOD-like receptor signaling pathway     111181978 (IL6)    04623 Cytosolic DNA-sensing pathway     111181978 (IL6)    04625 C-type lectin receptor signaling pathway     111181978 (IL6)    04659 Th17 cell differentiation     111181978 (IL6)    04657 IL-17 signaling pathway     111181978 (IL6)    04672 Intestinal immune network for IgA production     111181978 (IL6)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     111181978 (IL6)    05202 Transcriptional misregulation in cancer     111181978 (IL6)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     111181978 (IL6)    05161 Hepatitis B     111181978 (IL6)    05171 Coronavirus disease - COVID-19     111181978 (IL6)    05164 Influenza A     111181978 (IL6)    05162 Measles     111181978 (IL6)    05168 Herpes simplex virus 1 infection     111181978 (IL6)    05163 Human cytomegalovirus infection     111181978 (IL6)    05167 Kaposi sarcoma-associated herpesvirus infection     111181978 (IL6)    05169 Epstein-Barr virus infection     111181978 (IL6)   09171 Infectious disease: bacterial    05132 Salmonella infection     111181978 (IL6)    05135 Yersinia infection     111181978 (IL6)    05133 Pertussis     111181978 (IL6)    05134 Legionellosis     111181978 (IL6)    05152 Tuberculosis     111181978 (IL6)   09174 Infectious disease: parasitic    05146 Amoebiasis     111181978 (IL6)    05144 Malaria     111181978 (IL6)    05142 Chagas disease     111181978 (IL6)    05143 African trypanosomiasis     111181978 (IL6)   09163 Immune disease    05323 Rheumatoid arthritis     111181978 (IL6)    05321 Inflammatory bowel disease     111181978 (IL6)    05332 Graft-versus-host disease     111181978 (IL6)   09164 Neurodegenerative disease    05010 Alzheimer disease     111181978 (IL6)    05020 Prion disease     111181978 (IL6)    05022 Pathways of neurodegeneration - multiple diseases     111181978 (IL6)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     111181978 (IL6)    05410 Hypertrophic cardiomyopathy     111181978 (IL6)   09167 Endocrine and metabolic disease    04936 Alcoholic liver disease     111181978 (IL6)    04932 Non-alcoholic fatty liver disease     111181978 (IL6)    04931 Insulin resistance     111181978 (IL6)    04933 AGE-RAGE signaling pathway in diabetic complications     111181978 (IL6)   09176 Drug resistance: antineoplastic    01521 EGFR tyrosine kinase inhibitor resistance     111181978 (IL6)    01523 Antifolate resistance     111181978 (IL6)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:dle04052]     111181978 (IL6) Cytokines and neuropeptides [BR:dle04052]  Cytokines   Interleukins    111181978 (IL6) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  IL6 GCSF IL23 Tae4 Sec16 Motif Other DBs NCBI-GeneID:  111181978 NCBI-ProteinID:  XP_030615680 UniProt:  A0A7F8K587 LinkDB All DBs Position Unknown AA seq 208 aa AA seqDB search MNSLSTIAFSLGLLLVTATAFPTPGPLGEDFKDDTTSDRLLLTSPDKTEALIKYILGKIS AMRKEMCEKYDKCENSKEALAENNLNLPKMAEKDGCFQSGFNQETCLMRITTGLLEYQIY LDYLQNEYEGDKGSIEAVQISIKALAQILRQKVKNPDEVTTPDPTTNASLMNNLQSQNDD WMKNTKIILILRSLENFLQFSLRAVRIK NT seq 627 nt NT seq  +upstreamnt  +downstreamnt atgaactccctctccacaatcgccttctccctggggctgctcctggtgacggctactgct ttccctaccccgggacccctgggagaagatttcaaagatgataccacttcagacagacta ctcctcacctctccagacaaaactgaagctctcattaagtacatcctcggcaaaatctcc gcaatgagaaaggagatgtgtgagaagtatgacaagtgtgaaaacagcaaggaggcactg gcagaaaacaatctgaaccttccaaaaatggcagaaaaagacggatgcttccaatctggg ttcaatcaggagacttgcttgatgagaatcaccaccggtcttctggagtatcagatatac ctggactacctccagaacgagtatgagggtgataagggaagcatcgaggctgtgcagatt agcatcaaagcactggcccagatcctgaggcaaaaggtcaagaatccagatgaagtaacc acccctgacccaactacaaatgccagcctgatgaataacctgcagtcgcagaacgatgac tggatgaagaacacaaagattatcctcatcctgcgaagccttgagaacttcctgcagttc agcctgagggctgttcggatcaagtag

DBGET integrated database retrieval system