Delphinapterus leucas (beluga whale): 111186075 Help Entry 111186075         CDS       T05885                                  Symbol FGF2 Name (RefSeq) fibroblast growth factor 2   KO K18497   fibroblast growth factor 2 Organism dle  Delphinapterus leucas (beluga whale) Pathway dle01521   EGFR tyrosine kinase inhibitor resistance dle04010   MAPK signaling pathway dle04014   Ras signaling pathway dle04015   Rap1 signaling pathway dle04020   Calcium signaling pathway dle04151   PI3K-Akt signaling pathway dle04550   Signaling pathways regulating pluripotency of stem cells dle04810   Regulation of actin cytoskeleton dle05167   Kaposi sarcoma-associated herpesvirus infection dle05200   Pathways in cancer dle05205   Proteoglycans in cancer dle05207   Chemical carcinogenesis - receptor activation dle05218   Melanoma dle05224   Breast cancer dle05226   Gastric cancer Brite KEGG Orthology (KO) [BR:dle00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     111186075 (FGF2)    04014 Ras signaling pathway     111186075 (FGF2)    04015 Rap1 signaling pathway     111186075 (FGF2)    04020 Calcium signaling pathway     111186075 (FGF2)    04151 PI3K-Akt signaling pathway     111186075 (FGF2)  09140 Cellular Processes   09144 Cellular community - eukaryotes    04550 Signaling pathways regulating pluripotency of stem cells     111186075 (FGF2)   09142 Cell motility    04810 Regulation of actin cytoskeleton     111186075 (FGF2)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     111186075 (FGF2)    05205 Proteoglycans in cancer     111186075 (FGF2)    05207 Chemical carcinogenesis - receptor activation     111186075 (FGF2)   09162 Cancer: specific types    05226 Gastric cancer     111186075 (FGF2)    05218 Melanoma     111186075 (FGF2)    05224 Breast cancer     111186075 (FGF2)   09172 Infectious disease: viral    05167 Kaposi sarcoma-associated herpesvirus infection     111186075 (FGF2)   09176 Drug resistance: antineoplastic    01521 EGFR tyrosine kinase inhibitor resistance     111186075 (FGF2)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:dle04052]     111186075 (FGF2)    00536 Glycosaminoglycan binding proteins [BR:dle00536]     111186075 (FGF2) Cytokines and neuropeptides [BR:dle04052]  Cytokines   Growth factors (RTK binding)    111186075 (FGF2) Glycosaminoglycan binding proteins [BR:dle00536]  Heparan sulfate / Heparin   Growth factors/receptors    111186075 (FGF2) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  FGF Fascin IL1 Motif Other DBs NCBI-GeneID:  111186075 NCBI-ProteinID:  XP_030615929 UniProt:  A0A7F8K3J7 LinkDB All DBs Position Unknown AA seq 155 aa AA seqDB search MAAGSITTLPALPEDGGSDAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHV KLQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTDECFFFERLESNNYNTYRSRKY SSWYVALKRTGQYKLGPKTGPGQKAILFLPMSAKS NT seq 468 nt NT seq  +upstreamnt  +downstreamnt atggcagccgggagcatcaccacgctgcccgccctgccggaggacggcggcagcgacgcc ttcccgcccggccacttcaaggacccgaagcggctgtactgcaaaaacgggggcttcttc ctgcgcatccaccccgacggccgagtggacggggtccgcgagaagagcgaccctcacgtc aaactacaacttcaagcagaagagagaggggttgtgtctatcaaaggagtgtgtgcgaac cgttaccttgctatgaaggaagatggaagattactggcttctaaatgtgttacagacgag tgtttcttttttgaacgactggaatctaataactacaatacttaccggtcaaggaaatac tccagttggtatgtggcactgaagcgaactgggcagtataaacttggccccaaaacagga cctgggcagaaagctatactttttcttccaatgtctgctaagagctga

DBGET integrated database retrieval system