Diospyros lotus (date-plum): 127795893 Help Entry 127795893         CDS       T10632                                  Name (RefSeq) RING-box protein 1a-like   KO K03868   E3 ubiquitin-protein ligase RBX1 [EC:2.3.2.32] Organism dlt  Diospyros lotus (date-plum) Pathway dlt03420   Nucleotide excision repair dlt04120   Ubiquitin mediated proteolysis dlt04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:dlt00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     127795893    04120 Ubiquitin mediated proteolysis     127795893   09124 Replication and repair    03420 Nucleotide excision repair     127795893  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:dlt04121]     127795893    03400 DNA repair and recombination proteins [BR:dlt03400]     127795893 Enzymes [BR:dlt01000]  2. Transferases   2.3  Acyltransferases    2.3.2  Aminoacyltransferases     2.3.2.32  cullin-RING-type E3 NEDD8 transferase      127795893 Ubiquitin system [BR:dlt04121]  Ubiquitin ligases (E3)   UBL E3 ligases    127795893   Multi subunit type E3    SCF complex     Ring finger protein      127795893    Cul2 complex      127795893    Cul3 complex      127795893    Cul4 complex      127795893    Cul7 complex      127795893    Cul8 complex      127795893    Cul9 complex      127795893 DNA repair and recombination proteins [BR:dlt03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     GGR (global genome repair) factors      Cul4-DDB2 complex       127795893     TCR (transcription coupled repair) factors      Cul4-CSA complex       127795893 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  zf-rbx1 zf-ANAPC11 zf-RING_2 zf-C3HC4 zf-C3HC4_2 zf-RING_11 zf-RING_16 Motif Other DBs NCBI-GeneID:  127795893 NCBI-ProteinID:  XP_052183826 LinkDB All DBs Position 2:10183568..10187664 Genome browser AA seq 128 aa AA seqDB search MASLDTDVTMVPVGEGGGPGGAGPSSSTASTSSSSSKKAKRFEIKKWNAVALWAWDIVVD NCAICRNHIMDLCIECQANQASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNSE WEFQKYGH NT seq 387 nt NT seq  +upstreamnt  +downstreamnt atggcctctctcgacaccgacgtgacgatggttccggtgggtgagggcggtggtcccggc ggtgctggcccctcgtcttccaccgcctccacatcttcttcctcatcgaagaaggccaag cgattcgagatcaaaaagtggaacgccgttgctctctgggcttgggatatcgttgtggat aattgtgcgatctgccgtaaccatatcatggatctctgcattgagtgccaagctaatcaa gccagtgcaacaagcgaggaatgtactgttgcttggggggtttgcaatcatgcattccac ttccactgcatcagccgatggctaaaaacacgtcaagtgtgtccactggataacagtgag tgggaattccaaaagtatggacactag

DBGET integrated database retrieval system