Diospyros lotus (date-plum): 127806936 Help Entry 127806936         CDS       T10632                                  Name (RefSeq) RING-box protein 1a isoform X1   KO K03868   E3 ubiquitin-protein ligase RBX1 [EC:2.3.2.32] Organism dlt  Diospyros lotus (date-plum) Pathway dlt03420   Nucleotide excision repair dlt04120   Ubiquitin mediated proteolysis dlt04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:dlt00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     127806936    04120 Ubiquitin mediated proteolysis     127806936   09124 Replication and repair    03420 Nucleotide excision repair     127806936  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:dlt04121]     127806936    03400 DNA repair and recombination proteins [BR:dlt03400]     127806936 Enzymes [BR:dlt01000]  2. Transferases   2.3  Acyltransferases    2.3.2  Aminoacyltransferases     2.3.2.32  cullin-RING-type E3 NEDD8 transferase      127806936 Ubiquitin system [BR:dlt04121]  Ubiquitin ligases (E3)   UBL E3 ligases    127806936   Multi subunit type E3    SCF complex     Ring finger protein      127806936    Cul2 complex      127806936    Cul3 complex      127806936    Cul4 complex      127806936    Cul7 complex      127806936    Cul8 complex      127806936    Cul9 complex      127806936 DNA repair and recombination proteins [BR:dlt03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     GGR (global genome repair) factors      Cul4-DDB2 complex       127806936     TCR (transcription coupled repair) factors      Cul4-CSA complex       127806936 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  zf-rbx1 Motif Other DBs NCBI-GeneID:  127806936 NCBI-ProteinID:  XP_052200516 LinkDB All DBs Position 7:complement(26994845..27011894) Genome browser AA seq 141 aa AA seqDB search MASPDTGVTMIPAGEGPSSSAATGSSKKLRRFEIKKWNAVSLWAWDIVVDNCAICRNHIM DLCIECQANQASATSEECTVAWAGEVPTSTGANQVCTLQRVGATHWSSHFASVTRLIEMF GSTCTFLANLIDEGSNNSVRG NT seq 426 nt NT seq  +upstreamnt  +downstreamnt atggcttccccggacacgggcgtgacgatgattccggccggcgaggggccgtcttcctcc gctgctacggggtcgtccaagaagctgcggcgatttgaaatcaagaagtggaacgccgtc tctctttgggcttgggatattgttgtggataactgtgcgatttgcaggaaccatatcatg gatctctgcattgagtgccaggctaaccaagctagtgccacaagtgaggaatgtactgtt gcttgggcaggagaagttccgactagtactggagctaatcaagtttgtactttgcaacga gttggagctactcattggagttcacattttgcctctgttacaagattgattgagatgttt ggttctacttgtacatttcttgcaaatcttattgatgaggggtcgaacaatagcgtacgt gggtag

DBGET integrated database retrieval system