Drosophila melanogaster (fruit fly): Dmel_CG15237 Help Entry Dmel_CG15237      CDS       T00030                                  Symbol CG15237 Name (RefSeq) uncharacterized protein   KO K25228   anaphase-promoting complex subunit 15 Organism dme  Drosophila melanogaster (fruit fly) Pathway dme04120   Ubiquitin mediated proteolysis Brite KEGG Orthology (KO) [BR:dme00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     Dmel_CG15237 (CG15237)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:dme04121]     Dmel_CG15237 (CG15237)    03036 Chromosome and associated proteins [BR:dme03036]     Dmel_CG15237 (CG15237) Ubiquitin system [BR:dme04121]  Ubiquitin ligases (E3)   Multi subunit type E3    APC/C     Other subunits      Dmel_CG15237 (CG15237) Chromosome and associated proteins [BR:dme03036]  Eukaryotic type   Sister chromatid separation proteins    APC/C complex     Dmel_CG15237 (CG15237) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ANAPC15 Astro_capsid_p NOA36 Motif Other DBs NCBI-GeneID:  35591 NCBI-ProteinID:  NP_610238 FlyBase:  FBgn0033104 UniProt:  Q4V665 LinkDB All DBs Position 2R Genome browser AA seq 118 aa AA seqDB search MSMIPFFPTLKVSVANRYWLDMAPASVNEESQTRRYEDERSNWRESLKTAGTDLQPLGKM LTIPGIETDDEDANDDSEDTDSHDEEDDETNDRVIPVTQDFYSADDIQMNDETSPTAP NT seq 357 nt NT seq  +upstreamnt  +downstreamnt atgtcaatgattccattctttcccacgctcaaagtctccgtggccaatcgctactggttg gacatggctcctgcctccgtaaacgaagaatcgcagacgcggcgttatgaggatgaaagg agcaactggcgagagtcccttaagacggccggcacagatctgcagccgctgggcaaaatg ctcaccatacccggaattgagaccgacgacgaggatgccaacgacgacagcgaggacacg gacagtcacgatgaggaggatgacgagaccaacgaccgcgtcatcccggtaacccaggac ttttactccgccgacgacattcagatgaacgacgagacctcacccacagccccctaa

DBGET integrated database retrieval system