KEGG   Drosophila melanogaster (fruit fly): Dmel_CG16982
Entry
Dmel_CG16982      CDS       T00030                                 

Gene name
Roc1a
Definition
(RefSeq) regulator of cullins 1a, isoform D
  KO
K03868  E3 ubiquitin-protein ligase RBX1 [EC:2.3.2.32]
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
dme03420  Nucleotide excision repair
dme04120  Ubiquitin mediated proteolysis
dme04141  Protein processing in endoplasmic reticulum
dme04310  Wnt signaling pathway
dme04341  Hedgehog signaling pathway - fly
dme04350  TGF-beta signaling pathway
Brite
KEGG Orthology (KO) [BR:dme00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    Dmel_CG16982 (Roc1a)
   04120 Ubiquitin mediated proteolysis
    Dmel_CG16982 (Roc1a)
  09124 Replication and repair
   03420 Nucleotide excision repair
    Dmel_CG16982 (Roc1a)
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    Dmel_CG16982 (Roc1a)
   04341 Hedgehog signaling pathway - fly
    Dmel_CG16982 (Roc1a)
   04350 TGF-beta signaling pathway
    Dmel_CG16982 (Roc1a)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:dme04121]
    Dmel_CG16982 (Roc1a)
   03400 DNA repair and recombination proteins [BR:dme03400]
    Dmel_CG16982 (Roc1a)
Enzymes [BR:dme01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.32  cullin-RING-type E3 NEDD8 transferase
     Dmel_CG16982 (Roc1a)
Ubiquitin system [BR:dme04121]
 Ubiquitin ligases (E3)
  UBL E3 ligases
   Dmel_CG16982 (Roc1a)
  Multi subunit Ring-finger type E3
   SCF complex
    Ring finger protein
     Dmel_CG16982 (Roc1a)
   ECV complex
     Dmel_CG16982 (Roc1a)
   Cul3 complex
     Dmel_CG16982 (Roc1a)
   Cul4 complex
     Dmel_CG16982 (Roc1a)
   Cul7 complex
     Dmel_CG16982 (Roc1a)
   Cul9 complex
     Dmel_CG16982 (Roc1a)
DNA repair and recombination proteins [BR:dme03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    GGR (global genome repair) factors
     Cul4-DDB2 complex
      Dmel_CG16982 (Roc1a)
    TCR (transcription coupled repair) factors
     Cul4-CSA complex
      Dmel_CG16982 (Roc1a)
SSDB
Motif
Pfam: zf-rbx1 zf-ANAPC11 zf-RING_2 zf-C3HC4_2 zf-C3HC4 zf-C3HC4_3
Other DBs
NCBI-GeneID: 31014
NCBI-ProteinID: NP_001284754
FlyBase: FBgn0025638
UniProt: Q9W5E1 X2JA05
LinkDB
Position
X
AA seq 108 aa
MEVDEDGYEVPSSSSKGDKKRFEVKKWNAVALWAWDIVVDNCAICRNHIMDLCIECQANQ
ASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNREWDFQKYGH
NT seq 327 nt   +upstreamnt  +downstreamnt
atggaagtcgacgaggatggatacgaggttccctccagcagcagcaagggcgataagaag
cgctttgaggtgaagaagtggaacgccgtggctctgtgggcctgggacatcgtggtggac
aactgcgccatctgccgcaaccacatcatggacttgtgcatcgagtgtcaggcgaaccag
gcgtccgccactagcgaggagtgcaccgtggcctggggcgtctgcaaccacgccttccat
ttccactgcatctctcgctggctaaagacgcgccaggtatgcccactggacaaccgcgag
tgggatttccagaagtacggccactaa

KEGG   Drosophila melanogaster (fruit fly): Dmel_CG16988
Entry
Dmel_CG16988      CDS       T00030                                 

Gene name
Roc1b
Definition
(RefSeq) regulator of cullins 1b
  KO
K03868  E3 ubiquitin-protein ligase RBX1 [EC:2.3.2.32]
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
dme03420  Nucleotide excision repair
dme04120  Ubiquitin mediated proteolysis
dme04141  Protein processing in endoplasmic reticulum
dme04310  Wnt signaling pathway
dme04341  Hedgehog signaling pathway - fly
dme04350  TGF-beta signaling pathway
Brite
KEGG Orthology (KO) [BR:dme00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    Dmel_CG16988 (Roc1b)
   04120 Ubiquitin mediated proteolysis
    Dmel_CG16988 (Roc1b)
  09124 Replication and repair
   03420 Nucleotide excision repair
    Dmel_CG16988 (Roc1b)
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    Dmel_CG16988 (Roc1b)
   04341 Hedgehog signaling pathway - fly
    Dmel_CG16988 (Roc1b)
   04350 TGF-beta signaling pathway
    Dmel_CG16988 (Roc1b)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:dme04121]
    Dmel_CG16988 (Roc1b)
   03400 DNA repair and recombination proteins [BR:dme03400]
    Dmel_CG16988 (Roc1b)
Enzymes [BR:dme01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.32  cullin-RING-type E3 NEDD8 transferase
     Dmel_CG16988 (Roc1b)
Ubiquitin system [BR:dme04121]
 Ubiquitin ligases (E3)
  UBL E3 ligases
   Dmel_CG16988 (Roc1b)
  Multi subunit Ring-finger type E3
   SCF complex
    Ring finger protein
     Dmel_CG16988 (Roc1b)
   ECV complex
     Dmel_CG16988 (Roc1b)
   Cul3 complex
     Dmel_CG16988 (Roc1b)
   Cul4 complex
     Dmel_CG16988 (Roc1b)
   Cul7 complex
     Dmel_CG16988 (Roc1b)
   Cul9 complex
     Dmel_CG16988 (Roc1b)
DNA repair and recombination proteins [BR:dme03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    GGR (global genome repair) factors
     Cul4-DDB2 complex
      Dmel_CG16988 (Roc1b)
    TCR (transcription coupled repair) factors
     Cul4-CSA complex
      Dmel_CG16988 (Roc1b)
SSDB
Motif
Pfam: zf-rbx1 zf-ANAPC11 zf-RING_2 zf-C3HC4_2 zf-C3HC4 zf-RING_UBOX zf-RING_11
Other DBs
NCBI-GeneID: 53445
NCBI-ProteinID: NP_652613
FlyBase: FBgn0040291
UniProt: Q9NHX0
LinkDB
Position
3L
AA seq 122 aa
MAEEIEVEETEDFHDMDFNDEEPSCSGGAVQARTERFVVKKWVAHAMWGWDVAVDNCAIC
RNHIMNLCIECQADPNANQDECTVAWGECNHAFHYHCIARWLKTRLVCPLDNKEWVYQKY
GR
NT seq 369 nt   +upstreamnt  +downstreamnt
atggccgaggagatagaggttgaggagacggaggacttccacgacatggacttcaatgac
gaagagccatcctgtagtggaggagctgtccaggccaggacggagcgctttgtggtgaag
aaatgggttgcgcacgccatgtggggatgggacgtagcagtggacaactgtgccatctgc
cgtaaccacatcatgaacctgtgcatcgagtgccaggcggacccgaatgcaaaccaagac
gagtgcactgtggcttggggcgagtgcaaccacgcattccattaccactgcatcgcgcgc
tggttgaaaacgcgcctggtctgtccgctggacaacaaggagtgggtctaccagaagtac
ggccgctag

DBGET integrated database retrieval system