Drosophila melanogaster (fruit fly): Dmel_CG16982 Help Entry Dmel_CG16982      CDS       T00030                                  Symbol Roc1a Name (RefSeq) regulator of cullins 1a, isoform D   KO K03868   E3 ubiquitin-protein ligase RBX1 [EC:2.3.2.32] Organism dme  Drosophila melanogaster (fruit fly) Pathway dme03420   Nucleotide excision repair dme04120   Ubiquitin mediated proteolysis dme04141   Protein processing in endoplasmic reticulum dme04310   Wnt signaling pathway dme04341   Hedgehog signaling pathway - fly dme04350   TGF-beta signaling pathway Brite KEGG Orthology (KO) [BR:dme00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     Dmel_CG16982 (Roc1a)    04120 Ubiquitin mediated proteolysis     Dmel_CG16982 (Roc1a)   09124 Replication and repair    03420 Nucleotide excision repair     Dmel_CG16982 (Roc1a)  09130 Environmental Information Processing   09132 Signal transduction    04310 Wnt signaling pathway     Dmel_CG16982 (Roc1a)    04341 Hedgehog signaling pathway - fly     Dmel_CG16982 (Roc1a)    04350 TGF-beta signaling pathway     Dmel_CG16982 (Roc1a)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:dme04121]     Dmel_CG16982 (Roc1a)    03400 DNA repair and recombination proteins [BR:dme03400]     Dmel_CG16982 (Roc1a) Enzymes [BR:dme01000]  2. Transferases   2.3  Acyltransferases    2.3.2  Aminoacyltransferases     2.3.2.32  cullin-RING-type E3 NEDD8 transferase      Dmel_CG16982 (Roc1a) Ubiquitin system [BR:dme04121]  Ubiquitin ligases (E3)   UBL E3 ligases    Dmel_CG16982 (Roc1a)   Multi subunit Ring-finger type E3    SCF complex     Ring finger protein      Dmel_CG16982 (Roc1a)    Cul2 complex      Dmel_CG16982 (Roc1a)    Cul3 complex      Dmel_CG16982 (Roc1a)    Cul4 complex      Dmel_CG16982 (Roc1a)    Cul7 complex      Dmel_CG16982 (Roc1a)    Cul8 complex      Dmel_CG16982 (Roc1a)    Cul9 complex      Dmel_CG16982 (Roc1a) DNA repair and recombination proteins [BR:dme03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     GGR (global genome repair) factors      Cul4-DDB2 complex       Dmel_CG16982 (Roc1a)     TCR (transcription coupled repair) factors      Cul4-CSA complex       Dmel_CG16982 (Roc1a) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  zf-rbx1 zf-ANAPC11 zf-RING_2 zf-C3HC4 zf-C3HC4_2 zf-RING_11 zf-RING_16 Motif Other DBs NCBI-GeneID:  31014 NCBI-ProteinID:  NP_001284754 FlyBase:  FBgn0025638 UniProt:  Q9W5E1 X2JA05 LinkDB All DBs Position X:647304..648597 Genome browser AA seq 108 aa AA seqDB search MEVDEDGYEVPSSSSKGDKKRFEVKKWNAVALWAWDIVVDNCAICRNHIMDLCIECQANQ ASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNREWDFQKYGH NT seq 327 nt NT seq  +upstreamnt  +downstreamnt atggaagtcgacgaggatggatacgaggttccctccagcagcagcaagggcgataagaag cgctttgaggtgaagaagtggaacgccgtggctctgtgggcctgggacatcgtggtggac aactgcgccatctgccgcaaccacatcatggacttgtgcatcgagtgtcaggcgaaccag gcgtccgccactagcgaggagtgcaccgtggcctggggcgtctgcaaccacgccttccat ttccactgcatctctcgctggctaaagacgcgccaggtatgcccactggacaaccgcgag tgggatttccagaagtacggccactaa

Drosophila melanogaster (fruit fly): Dmel_CG16988 Help Entry Dmel_CG16988      CDS       T00030                                  Symbol Roc1b Name (RefSeq) regulator of cullins 1b   KO K03868   E3 ubiquitin-protein ligase RBX1 [EC:2.3.2.32] Organism dme  Drosophila melanogaster (fruit fly) Pathway dme03420   Nucleotide excision repair dme04120   Ubiquitin mediated proteolysis dme04141   Protein processing in endoplasmic reticulum dme04310   Wnt signaling pathway dme04341   Hedgehog signaling pathway - fly dme04350   TGF-beta signaling pathway Brite KEGG Orthology (KO) [BR:dme00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     Dmel_CG16988 (Roc1b)    04120 Ubiquitin mediated proteolysis     Dmel_CG16988 (Roc1b)   09124 Replication and repair    03420 Nucleotide excision repair     Dmel_CG16988 (Roc1b)  09130 Environmental Information Processing   09132 Signal transduction    04310 Wnt signaling pathway     Dmel_CG16988 (Roc1b)    04341 Hedgehog signaling pathway - fly     Dmel_CG16988 (Roc1b)    04350 TGF-beta signaling pathway     Dmel_CG16988 (Roc1b)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:dme04121]     Dmel_CG16988 (Roc1b)    03400 DNA repair and recombination proteins [BR:dme03400]     Dmel_CG16988 (Roc1b) Enzymes [BR:dme01000]  2. Transferases   2.3  Acyltransferases    2.3.2  Aminoacyltransferases     2.3.2.32  cullin-RING-type E3 NEDD8 transferase      Dmel_CG16988 (Roc1b) Ubiquitin system [BR:dme04121]  Ubiquitin ligases (E3)   UBL E3 ligases    Dmel_CG16988 (Roc1b)   Multi subunit Ring-finger type E3    SCF complex     Ring finger protein      Dmel_CG16988 (Roc1b)    Cul2 complex      Dmel_CG16988 (Roc1b)    Cul3 complex      Dmel_CG16988 (Roc1b)    Cul4 complex      Dmel_CG16988 (Roc1b)    Cul7 complex      Dmel_CG16988 (Roc1b)    Cul8 complex      Dmel_CG16988 (Roc1b)    Cul9 complex      Dmel_CG16988 (Roc1b) DNA repair and recombination proteins [BR:dme03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     GGR (global genome repair) factors      Cul4-DDB2 complex       Dmel_CG16988 (Roc1b)     TCR (transcription coupled repair) factors      Cul4-CSA complex       Dmel_CG16988 (Roc1b) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  zf-rbx1 zf-ANAPC11 zf-RING_2 zf-C3HC4_2 zf-C3HC4 zf-RING_UBOX Motif Other DBs NCBI-GeneID:  53445 NCBI-ProteinID:  NP_652613 FlyBase:  FBgn0040291 UniProt:  Q9NHX0 LinkDB All DBs Position 3L Genome browser AA seq 122 aa AA seqDB search MAEEIEVEETEDFHDMDFNDEEPSCSGGAVQARTERFVVKKWVAHAMWGWDVAVDNCAIC RNHIMNLCIECQADPNANQDECTVAWGECNHAFHYHCIARWLKTRLVCPLDNKEWVYQKY GR NT seq 369 nt NT seq  +upstreamnt  +downstreamnt atggccgaggagatagaggttgaggagacggaggacttccacgacatggacttcaatgac gaagagccatcctgtagtggaggagctgtccaggccaggacggagcgctttgtggtgaag aaatgggttgcgcacgccatgtggggatgggacgtagcagtggacaactgtgccatctgc cgtaaccacatcatgaacctgtgcatcgagtgccaggcggacccgaatgcaaaccaagac gagtgcactgtggcttggggcgagtgcaaccacgcattccattaccactgcatcgcgcgc tggttgaaaacgcgcctggtctgtccgctggacaacaaggagtgggtctaccagaagtac ggccgctag

DBGET integrated database retrieval system