KEGG   Drosophila melanogaster (fruit fly): Dmel_CG34404
Entry
Dmel_CG34404      CDS       T00030                                 
Symbol
CG34404
Name
(RefSeq) uncharacterized protein, isoform E
  KO
K26734  colorectal mutant cancer protein
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
dme04310  Wnt signaling pathway
Brite
KEGG Orthology (KO) [BR:dme00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    Dmel_CG34404 (CG34404)
SSDB
Motif
Pfam: USHBP1_PDZ-bd Docking bZIP_1 BMT5-like DUF5805
Other DBs
NCBI-GeneID: 41873
NCBI-ProteinID: NP_650456
FlyBase: FBgn0085433
UniProt: Q7KSI6
LinkDB
Position
3R
AA seq 565 aa
MHCVIAELSKKLRSKQDHVIMEEQEPDGSELSFQEGSVYNSELNLTNPDAECQTEPLEDF
EGACSTTSVGNVAHKPPELSHKGQVEALQEEVLHLRARIALLQSEISTKDAAVVEEQTKV
AFDCESEVNECGQRLNDLNVCTSLTSPQKRIPAVPKMAERVKLRCASKHESGEDPSQDTS
LSNEQINLVEHLVSELKEQNLYMENFMEPLHLSKDLERLQRRVEQLEMRNTMLALTLDEC
KEHTEHLYLLCGKYESNAVALQLALNCSDRAIEAYDVMLALLESKLALLGEKSVAAEESR
RSVEAVARHLLARLDSEKNVCENSLGPWQHNINLGPEDAPKTGRPWCADDDNRLRYHVSK
LKGRRSNVQHTIVSLESPFSDIYERKRLALEKEHELRSADKKSPIDLETAVIMQEILELR
DSNLQLKTKMEEAEQERQNANERVGILHEALKQLQANNRVSYSEAEHAALTEQQLVEALT
RETELKGRIQTLLANVTASQKAFDEKYEQLHQNVRELQKSNHNLGQMLDHTKRKYQLRVR
KLEQKIVDLRLDYEQGHNHVPETTL
NT seq 1698 nt   +upstreamnt  +downstreamnt
atgcactgtgtcatcgccgagttaagcaagaaattgcgcagtaagcaggaccacgttatc
atggaggagcaggagcccgacggcagcgaactcagctttcaggagggttcagtgtacaat
tccgagcttaacctcaccaatcctgatgccgaatgtcaaacagaaccactggaagacttc
gagggcgcctgcagtaccaccagcgtgggtaacgttgcccacaaaccgccggaactgagc
cataagggacaagtggaggcactgcaggaggaagttctgcacttgagagctcgaatcgcc
ctcctccagtccgagatttccaccaaggatgctgctgtggtcgaggaacagaccaaagtc
gccttcgactgcgaatcggaagtcaacgagtgcggacagcgactgaatgatttgaatgtt
tgcacttccttgacaagtccgcaaaaacgcattccagcggtaccgaaaatggctgaacgg
gttaagttgcggtgcgccagcaaacatgaatccggagaagatccatcccaagatacttca
ttgagcaacgagcaaattaatctggtcgaacatttggtgtcggagctaaaggagcaaaat
ctatatatggagaactttatggagcccctacatttgagcaaagacttggagcgactgcaa
cgacgtgttgaacaattggagatgcgaaacaccatgctggcactgacgctagacgaatgc
aaggagcacactgagcatctgtatctgctatgcggaaagtacgagtccaatgcggttgct
cttcagttggcgcttaattgcagtgatcgcgccatcgaggcctacgacgtaatgttggct
ctgctcgaaagcaagttggcactgctgggggagaaatcagtggcagcggaagagagtcga
cgatcggtggaggcggtggccaggcacctgctagcccgtttggatagcgagaaaaacgtt
tgtgagaacagcctgggaccgtggcaacacaacatcaacctgggcccagaggatgcccca
aaaactggccgcccgtggtgtgccgacgacgacaaccgcctgcgttaccacgtctccaag
ctgaagggacgtcgttccaatgtccagcataccattgtcagtttggaatcacccttcagc
gacatatacgaaagaaagcgcctggctttggaaaaggagcacgaacttcggagcgcggac
aagaagtcacccattgacttggagacagcagtgattatgcaagaaatactcgagctgcgg
gattcgaatttgcagctgaagacaaaaatggaagaggccgagcaggaacggcagaacgcc
aacgaacgagtgggcatactccacgaagccctaaagcagctacaggcaaacaaccgggtc
tcgtattcggaggcggagcatgcggctctcacagagcagcagttggtggaggccttaact
cgagaaacggagctcaagggtcgcatacagacgctattggcaaatgtaacagcttcgcag
aaggccttcgacgaaaaatacgagcaactgcatcagaacgtgcgtgaactgcagaaatcc
aaccacaatctgggccaaatgttagatcacaccaagcgcaagtaccagctgcgggtgagg
aagctagagcagaagattgttgacctgcggctggactacgagcaaggccataaccatgtt
cctgagactactctgtag

DBGET integrated database retrieval system