Drosophila melanogaster (fruit fly): Dmel_CG9669 Help Entry Dmel_CG9669       CDS       T00030                                  Symbol kud Name (RefSeq) kuduk, isoform B   KO K26502   transmembrane protein 258 Organism dme  Drosophila melanogaster (fruit fly) Pathway dme00510   N-Glycan biosynthesis dme00513   Various types of N-glycan biosynthesis dme04141   Protein processing in endoplasmic reticulum Module dme_M00072   N-glycosylation by oligosaccharyltransferase Brite KEGG Orthology (KO) [BR:dme00001]  09100 Metabolism   09107 Glycan biosynthesis and metabolism    00510 N-Glycan biosynthesis     Dmel_CG9669 (kud)    00513 Various types of N-glycan biosynthesis     Dmel_CG9669 (kud)  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     Dmel_CG9669 (kud) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ost5 Cation_efflux DUF6512 DUF4010 Pox_E2-like CAAD YebO DUF6404 Motif Other DBs NCBI-GeneID:  39882 NCBI-ProteinID:  NP_001246807 FlyBase:  FBgn0036667 UniProt:  Q9VVA8 G2J5U1 LinkDB All DBs Position 3L Genome browser AA seq 78 aa AA seqDB search MDVMQRYVSPVNPAVFPHLATVLLVIGTFFTAWFFIFVVSRKSSKESTLIKELLISLCAS IFLGFGIVFLLLTVGIYV NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atggacgtaatgcagcgctacgtatcgcccgtgaacccggccgtttttccccacctcgcc accgtgcttttggtcatcggaaccttcttcaccgcctggttcttcatctttgtggtgtct cgaaagagctctaaggaaagcaccttgataaaggaactgctgattagcctgtgcgcctcc attttcctgggattcggcattgttttcctgcttctaaccgtcggtatttacgtatga

DBGET integrated database retrieval system