Drosophila miranda: 108152103 Help Entry 108152103         CDS       T06132                                  Name (RefSeq) transmembrane protein 258   KO K26502   transmembrane protein 258 Organism dmn  Drosophila miranda Pathway dmn00510   N-Glycan biosynthesis dmn00513   Various types of N-glycan biosynthesis dmn04141   Protein processing in endoplasmic reticulum Module dmn_M00072   N-glycosylation by oligosaccharyltransferase Brite KEGG Orthology (KO) [BR:dmn00001]  09100 Metabolism   09107 Glycan biosynthesis and metabolism    00510 N-Glycan biosynthesis     108152103    00513 Various types of N-glycan biosynthesis     108152103  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     108152103 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ost5 Cation_efflux DUF6512 Pox_E2-like DUF4010 Motif Other DBs NCBI-GeneID:  108152103 NCBI-ProteinID:  XP_017136643 LinkDB All DBs Position XR:641959..642431 Genome browser AA seq 83 aa AA seqDB search MNTVSFENMKRYVSPINPAVFPHLATVLLTIGTFFTAWFFIFVVSRKTTKEKTLIKELLI SLCASIFLGFGIVFLLLTVGIYV NT seq 252 nt NT seq  +upstreamnt  +downstreamnt atgaataccgtctcgtttgaaaacatgaagcgctacgtttcgcccatcaatccagcggta ttcccccacctcgcgaccgtgcttctcaccatcggaacattcttcacggcctggttcttc atctttgtcgtatcccggaagaccaccaaggaaaagactctgattaaggaactgctgatt agcctgtgtgcctcgatatttctcggctttggcattgtgttccttctactcaccgtcggt atttacgtatga

DBGET integrated database retrieval system