Drosophila miranda: 108164784 Help Entry 108164784         CDS       T06132                                  Name (RefSeq) RING-box protein 1A   KO K03868   E3 ubiquitin-protein ligase RBX1 [EC:2.3.2.32] Organism dmn  Drosophila miranda Pathway dmn03420   Nucleotide excision repair dmn04120   Ubiquitin mediated proteolysis dmn04141   Protein processing in endoplasmic reticulum dmn04310   Wnt signaling pathway dmn04341   Hedgehog signaling pathway - fly dmn04350   TGF-beta signaling pathway Brite KEGG Orthology (KO) [BR:dmn00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     108164784    04120 Ubiquitin mediated proteolysis     108164784   09124 Replication and repair    03420 Nucleotide excision repair     108164784  09130 Environmental Information Processing   09132 Signal transduction    04310 Wnt signaling pathway     108164784    04341 Hedgehog signaling pathway - fly     108164784    04350 TGF-beta signaling pathway     108164784  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:dmn04121]     108164784    03400 DNA repair and recombination proteins [BR:dmn03400]     108164784 Enzymes [BR:dmn01000]  2. Transferases   2.3  Acyltransferases    2.3.2  Aminoacyltransferases     2.3.2.32  cullin-RING-type E3 NEDD8 transferase      108164784 Ubiquitin system [BR:dmn04121]  Ubiquitin ligases (E3)   UBL E3 ligases    108164784   Multi subunit type E3    SCF complex     Ring finger protein      108164784    Cul2 complex      108164784    Cul3 complex      108164784    Cul4 complex      108164784    Cul7 complex      108164784    Cul8 complex      108164784    Cul9 complex      108164784 DNA repair and recombination proteins [BR:dmn03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     GGR (global genome repair) factors      Cul4-DDB2 complex       108164784     TCR (transcription coupled repair) factors      Cul4-CSA complex       108164784 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  zf-rbx1 zf-ANAPC11 zf-RING_2 zf-C3HC4 zf-C3HC4_2 zf-RING_11 DUF8003 Motif Other DBs NCBI-GeneID:  108164784 NCBI-ProteinID:  XP_017156196 LinkDB All DBs Position XL:complement(481658..482715) Genome browser AA seq 112 aa AA seqDB search MDRNMEVDEEEFEVPSSSSKGEKKRFEVKKWNAVALWAWDIVVDNCAICRNHIMDLCIEC QANQASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNREWDFQKYGH NT seq 339 nt NT seq  +upstreamnt  +downstreamnt atggacagaaacatggaggttgacgaggaagaatttgaggtgccatccagcagtagtaag ggcgaaaagaagcgcttcgaggttaagaaatggaacgccgtagctctatgggcctgggat atcgttgttgacaattgcgccatttgccgcaaccacataatggacttgtgcatcgagtgc caggctaaccaggcctctgccaccagcgaggagtgtaccgtggcctggggcgtctgtaat catgccttccactttcactgcatttcgcgttggctgaagactcgtcaggtgtgccccttg gacaaccgcgagtgggacttccagaagtacggtcactag

DBGET integrated database retrieval system