Drosophila mojavensis: Dmoj_GI25778 Help Entry Dmoj_GI25778      CDS       T01062                                  Name (GenBank) uncharacterized protein   KO K03868   E3 ubiquitin-protein ligase RBX1 [EC:2.3.2.32] Organism dmo  Drosophila mojavensis Pathway dmo03420   Nucleotide excision repair dmo04120   Ubiquitin mediated proteolysis dmo04141   Protein processing in endoplasmic reticulum dmo04310   Wnt signaling pathway dmo04341   Hedgehog signaling pathway - fly dmo04350   TGF-beta signaling pathway Brite KEGG Orthology (KO) [BR:dmo00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     Dmoj_GI25778    04120 Ubiquitin mediated proteolysis     Dmoj_GI25778   09124 Replication and repair    03420 Nucleotide excision repair     Dmoj_GI25778  09130 Environmental Information Processing   09132 Signal transduction    04310 Wnt signaling pathway     Dmoj_GI25778    04341 Hedgehog signaling pathway - fly     Dmoj_GI25778    04350 TGF-beta signaling pathway     Dmoj_GI25778  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:dmo04121]     Dmoj_GI25778    03400 DNA repair and recombination proteins [BR:dmo03400]     Dmoj_GI25778 Enzymes [BR:dmo01000]  2. Transferases   2.3  Acyltransferases    2.3.2  Aminoacyltransferases     2.3.2.32  cullin-RING-type E3 NEDD8 transferase      Dmoj_GI25778 Ubiquitin system [BR:dmo04121]  Ubiquitin ligases (E3)   UBL E3 ligases    Dmoj_GI25778   Multi subunit type E3    SCF complex     Ring finger protein      Dmoj_GI25778    Cul2 complex      Dmoj_GI25778    Cul3 complex      Dmoj_GI25778    Cul4 complex      Dmoj_GI25778    Cul7 complex      Dmoj_GI25778    Cul8 complex      Dmoj_GI25778    Cul9 complex      Dmoj_GI25778 DNA repair and recombination proteins [BR:dmo03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     GGR (global genome repair) factors      Cul4-DDB2 complex       Dmoj_GI25778     TCR (transcription coupled repair) factors      Cul4-CSA complex       Dmoj_GI25778 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  zf-rbx1 zf-ANAPC11 zf-RING_2 zf-C3HC4_2 zf-C3HC4 zf-RING_UBOX zf-RING_16 Lin-15B zf-RING_11 Motif Other DBs NCBI-ProteinID:  KRG07083 UniProt:  A0A0Q9XEX1 LinkDB All DBs AA seq 98 aa AA seqDB search MKEFEKINNDATDEKSTRFQIMNWNANAFWAWDIGVDTCAICRNHIDELCNECLSNMSVD CPKACGVCQHVYHYHCISRWLAKRHVCPLDYLAWQYKN NT seq 297 nt NT seq  +upstreamnt  +downstreamnt atgaaagaatttgagaaaattaataatgatgccactgacgagaaaagcacccgcttccaa ataatgaattggaatgccaatgctttttgggcttgggatattggggttgatacttgcgcc atttgtcgcaatcacattgatgagctatgcaacgagtgcctatcgaatatgtccgttgat tgcccgaaggcttgcggggtctgccagcacgtttaccactaccattgtatttcgcgctgg ctggctaagcgtcatgtctgtcccttggactatctcgcctggcaatataaaaactga

DBGET integrated database retrieval system