Dromaius novaehollandiae (emu): 112984067 Help Entry 112984067         CDS       T07572                                  Symbol RBX1 Name (RefSeq) E3 ubiquitin-protein ligase RBX1   KO K03868   E3 ubiquitin-protein ligase RBX1 [EC:2.3.2.32] Organism dne  Dromaius novaehollandiae (emu) Pathway dne03420   Nucleotide excision repair dne04110   Cell cycle dne04114   Oocyte meiosis dne04120   Ubiquitin mediated proteolysis dne04141   Protein processing in endoplasmic reticulum dne04310   Wnt signaling pathway dne04350   TGF-beta signaling pathway Brite KEGG Orthology (KO) [BR:dne00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     112984067 (RBX1)    04120 Ubiquitin mediated proteolysis     112984067 (RBX1)   09124 Replication and repair    03420 Nucleotide excision repair     112984067 (RBX1)  09130 Environmental Information Processing   09132 Signal transduction    04310 Wnt signaling pathway     112984067 (RBX1)    04350 TGF-beta signaling pathway     112984067 (RBX1)  09140 Cellular Processes   09143 Cell growth and death    04110 Cell cycle     112984067 (RBX1)    04114 Oocyte meiosis     112984067 (RBX1)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:dne04121]     112984067 (RBX1)    03400 DNA repair and recombination proteins [BR:dne03400]     112984067 (RBX1) Enzymes [BR:dne01000]  2. Transferases   2.3  Acyltransferases    2.3.2  Aminoacyltransferases     2.3.2.32  cullin-RING-type E3 NEDD8 transferase      112984067 (RBX1) Ubiquitin system [BR:dne04121]  Ubiquitin ligases (E3)   UBL E3 ligases    112984067 (RBX1)   Multi subunit type E3    SCF complex     Ring finger protein      112984067 (RBX1)    Cul2 complex      112984067 (RBX1)    Cul3 complex      112984067 (RBX1)    Cul4 complex      112984067 (RBX1)    Cul7 complex      112984067 (RBX1)    Cul8 complex      112984067 (RBX1)    Cul9 complex      112984067 (RBX1) DNA repair and recombination proteins [BR:dne03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     GGR (global genome repair) factors      Cul4-DDB2 complex       112984067 (RBX1)     TCR (transcription coupled repair) factors      Cul4-CSA complex       112984067 (RBX1) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  zf-rbx1 zf-ANAPC11 zf-RING_2 zf-C3HC4 zf-C3HC4_2 zf-RING_11 zf-RING_16 Motif Other DBs NCBI-GeneID:  112984067 NCBI-ProteinID:  XP_025957436 Ensembl:  ENSDNVG00000005299 UniProt:  A0A8C4JEQ9 LinkDB All DBs Position Unknown AA seq 108 aa AA seqDB search MAAAMDVDTPSGTNSGAGKKRFEVKKWNAVALWAWDIVVDNCAICRNHIMDLCIECQANQ ASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNREWEFQKYGH NT seq 327 nt NT seq  +upstreamnt  +downstreamnt atggcggccgcgatggatgtggatacccctagcggcactaacagcggcgccggcaagaag cgcttcgaagtgaagaaatggaatgcagtagctctgtgggcatgggacattgtggttgat aactgtgccatttgcagaaaccatattatggatctatgcatagaatgtcaagcaaaccaa gcatcagctacctctgaagagtgcacagttgcatggggcgtctgcaatcatgctttccac ttccactgcatctctcgctggctcaaaactcgccaagtatgtccgttggacaacagggaa tgggagtttcaaaagtatggacattag

DBGET integrated database retrieval system