Dromaius novaehollandiae (emu): 112986051 Help Entry 112986051         CDS       T07572                                  Symbol IL6 Name (RefSeq) interleukin-6   KO K05405   interleukin 6 Organism dne  Dromaius novaehollandiae (emu) Pathway dne04060   Cytokine-cytokine receptor interaction dne04068   FoxO signaling pathway dne04218   Cellular senescence dne04620   Toll-like receptor signaling pathway dne04621   NOD-like receptor signaling pathway dne04623   Cytosolic DNA-sensing pathway dne04625   C-type lectin receptor signaling pathway dne04672   Intestinal immune network for IgA production dne05132   Salmonella infection dne05164   Influenza A dne05168   Herpes simplex virus 1 infection Brite KEGG Orthology (KO) [BR:dne00001]  09130 Environmental Information Processing   09132 Signal transduction    04068 FoxO signaling pathway     112986051 (IL6)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     112986051 (IL6)  09140 Cellular Processes   09143 Cell growth and death    04218 Cellular senescence     112986051 (IL6)  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     112986051 (IL6)    04621 NOD-like receptor signaling pathway     112986051 (IL6)    04623 Cytosolic DNA-sensing pathway     112986051 (IL6)    04625 C-type lectin receptor signaling pathway     112986051 (IL6)    04672 Intestinal immune network for IgA production     112986051 (IL6)  09160 Human Diseases   09172 Infectious disease: viral    05164 Influenza A     112986051 (IL6)    05168 Herpes simplex virus 1 infection     112986051 (IL6)   09171 Infectious disease: bacterial    05132 Salmonella infection     112986051 (IL6)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:dne04052]     112986051 (IL6) Cytokines and neuropeptides [BR:dne04052]  Cytokines   Interleukins    112986051 (IL6) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  IL6 GCSF IL23 Motif Other DBs NCBI-GeneID:  112986051 NCBI-ProteinID:  XP_025960906 LinkDB All DBs Position Unknown AA seq 150 aa AA seqDB search MCEKFTVCENSMEMLVQNNLNLPKVTEEDGCLLSGFNEERCLRKLSSGLFTFQTYLEYVQ ETFTSERQKVESLCYSTKHLATTIRQMVINPDEVIIPDSATQKSLLAKLKSDKTWIEKIT THLILRDFTSFMEKTVRAVRYLKNTRSISV NT seq 453 nt NT seq  +upstreamnt  +downstreamnt atgtgcgagaagtttaccgtctgcgagaacagcatggaaatgctcgtccagaacaacctc aacctccccaaggtgacggaggaagatgggtgtctcctctccggcttcaacgaggagagg tgcttgaggaagctctccagcgggcttttcacgtttcagacctaccttgagtacgtgcaa gaaacttttactagtgaaaggcaaaaagttgaatcgctctgctatagcacgaagcatctg gcaactaccataagacagatggtgataaatcctgatgaagtgatcatcccagactcagct acccagaagtcccttcttgcaaagctgaagtcagataagacctggatagagaagatcacc acacaccttatcctccgagactttacttcgtttatggagaaaactgtgagggctgttcgc tatttgaaaaacaccaggagtatcagtgtttga

DBGET integrated database retrieval system