Dromaius novaehollandiae (emu): 112992095 Help Entry 112992095         CDS       T07572                                  Name (RefSeq) hepatic lectin-like isoform X1   KO K06563   C-type lectin domain family 4 member L/M Organism dne  Dromaius novaehollandiae (emu) Pathway dne03260   Virion - Human immunodeficiency virus dne03264   Virion - Flavivirus and Alphavirus dne03265   Virion - Ebolavirus, Lyssavirus and Morbillivirus dne03273   Virion - Lassa virus and SFTS virus dne04145   Phagosome dne04625   C-type lectin receptor signaling pathway Brite KEGG Orthology (KO) [BR:dne00001]  09120 Genetic Information Processing   09125 Information processing in viruses    03260 Virion - Human immunodeficiency virus     112992095    03264 Virion - Flavivirus and Alphavirus     112992095    03265 Virion - Ebolavirus, Lyssavirus and Morbillivirus     112992095    03273 Virion - Lassa virus and SFTS virus     112992095  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     112992095  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     112992095  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:dne04131]     112992095   09183 Protein families: signaling and cellular processes    04054 Pattern recognition receptors [BR:dne04054]     112992095    04515 Cell adhesion molecules [BR:dne04515]     112992095    04090 CD molecules [BR:dne04090]     112992095    04091 Lectins [BR:dne04091]     112992095 Membrane trafficking [BR:dne04131]  Endocytosis   Phagocytosis    C-lectin receptors     112992095 Pattern recognition receptors [BR:dne04054]  Membrane-bound pattern recognition receptors   C-type lectin receptors    112992095 Cell adhesion molecules [BR:dne04515]  Lectins   Selectins and C-type lectins    112992095 CD molecules [BR:dne04090]  Proteins   112992095 Lectins [BR:dne04091]  C-Type lectins   Asialoglycoprotein and DC receptors    112992095 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Lectin_C Motif Other DBs NCBI-GeneID:  112992095 NCBI-ProteinID:  XP_025970761 Ensembl:  ENSDNVG00000002494 LinkDB All DBs Position Unknown AA seq 216 aa AA seqDB search MDEEHLHDELHVFKDRNFFQQKLRSFFTVYLLLALSFLLSITLFAVSLSRVSALSSKLHE VHLQRKQNYSGTDFLLFPCGPGSREWEYFDRKCYYFSLRRTSWHKAKAHCEEMHSQLAVI DSYAKQNFVMFRTRNERFWIGLTDENSEGEWEWIDGTDYKATFTLDFTLQNCPALVCHQT KLDHCSTPCDFTGDWQRYRKRWGRTVHTTHLCTNSS NT seq 651 nt NT seq  +upstreamnt  +downstreamnt atggatgaggagcatcttcatgatgaactgcatgtttttaaagacagaaactttttccag cagaagctgagatcctttttcacagtatacttgctgctggcactctctttcttgctgagc atcaccctgtttgctgtgtcactctccagagtttcagccctttcttctaaactccatgag gtgcacctgcaacggaaacagaactattctggcacagatttcctgttgtttccctgtgga cctggatcgagggagtgggaatactttgacagaaaatgttactacttctccctgcgtaga acgagctggcacaaggcaaaggctcactgtgaagagatgcattcacagctggctgtcatt gatagctacgccaagcagaattttgtcatgttcaggacaaggaacgaacgcttctggatt gggctcacagatgagaactcagaaggggaatgggaatggatcgatgggactgactacaaa gccacattcactttggatttcacattacaaaattgcccagcacttgtttgtcaccagaca aaacttgatcattgttcaactccctgtgacttcactggtgactggcaaaggtaccgcaaa cgctggggaaggactgttcacaccactcacctctgcactaatagcagttaa

DBGET integrated database retrieval system