Drosophila navojoa: 108655043 Help Entry 108655043         CDS       T05898                                  Name (RefSeq) RING-box protein 1-like   KO K03868   E3 ubiquitin-protein ligase RBX1 [EC:2.3.2.32] Organism dnv  Drosophila navojoa Pathway dnv03420   Nucleotide excision repair dnv04120   Ubiquitin mediated proteolysis dnv04141   Protein processing in endoplasmic reticulum dnv04310   Wnt signaling pathway dnv04341   Hedgehog signaling pathway - fly dnv04350   TGF-beta signaling pathway Brite KEGG Orthology (KO) [BR:dnv00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     108655043    04120 Ubiquitin mediated proteolysis     108655043   09124 Replication and repair    03420 Nucleotide excision repair     108655043  09130 Environmental Information Processing   09132 Signal transduction    04310 Wnt signaling pathway     108655043    04341 Hedgehog signaling pathway - fly     108655043    04350 TGF-beta signaling pathway     108655043  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:dnv04121]     108655043    03400 DNA repair and recombination proteins [BR:dnv03400]     108655043 Enzymes [BR:dnv01000]  2. Transferases   2.3  Acyltransferases    2.3.2  Aminoacyltransferases     2.3.2.32  cullin-RING-type E3 NEDD8 transferase      108655043 Ubiquitin system [BR:dnv04121]  Ubiquitin ligases (E3)   UBL E3 ligases    108655043   Multi subunit type E3    SCF complex     Ring finger protein      108655043    Cul2 complex      108655043    Cul3 complex      108655043    Cul4 complex      108655043    Cul7 complex      108655043    Cul8 complex      108655043    Cul9 complex      108655043 DNA repair and recombination proteins [BR:dnv03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     GGR (global genome repair) factors      Cul4-DDB2 complex       108655043     TCR (transcription coupled repair) factors      Cul4-CSA complex       108655043 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  zf-rbx1 zf-ANAPC11 zf-RING_2 zf-C3HC4 zf-C3HC4_2 zf-RING_11 Motif Other DBs NCBI-GeneID:  108655043 NCBI-ProteinID:  XP_017962218 UniProt:  A0A484BST9 LinkDB All DBs Position Unknown AA seq 138 aa AA seqDB search MSGNRNERPTTSAGAAGGDGNDSGNGKNNDKGQGNGSGIGKDNVSGMDRKRFNVKKWNGV ALWSWDIVVDNCAICRNHIMDPCIQCQANQSTNSGSECTVAWGSCNHAFHFHCISHWLKT RPVCPLDNLEWNFEKYGR NT seq 417 nt NT seq  +upstreamnt  +downstreamnt atgagcggcaatcgtaacgagcgaccaacaaccagcgcaggcgcagccggcggcgatggc aatgacagcggcaacggcaagaacaacgacaagggccaggggaatggaagtggaatcgga aaggacaacgtcagcggcatggatcgcaagcgtttcaatgtcaagaaatggaatggcgtt gcgctctggtcctgggatatagtcgtcgataactgtgccatttgtcgcaatcatattatg gatccgtgcattcaatgccaggcgaatcagtcgaccaacagcggctccgagtgcaccgtc gcctggggctcgtgcaatcatgcctttcacttccattgcatttcgcattggctgaagaca cgtcccgtctgtcccctggacaatctcgagtggaactttgagaaatatggacgttag

DBGET integrated database retrieval system