Marivivens sp. JLT3646: BSK21_07785
Help
Entry
BSK21_07785 CDS
T04589
Name
(GenBank) 3-oxoacyl-[acyl-carrier-protein] reductase
KO
K00059
3-oxoacyl-[acyl-carrier protein] reductase [EC:
1.1.1.100
]
Organism
don
Marivivens sp. JLT3646
Pathway
don00061
Fatty acid biosynthesis
don00780
Biotin metabolism
don01100
Metabolic pathways
don01110
Biosynthesis of secondary metabolites
don01212
Fatty acid metabolism
don01240
Biosynthesis of cofactors
Module
don_M00083
Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:
don00001
]
09100 Metabolism
09103 Lipid metabolism
00061 Fatty acid biosynthesis
BSK21_07785
09108 Metabolism of cofactors and vitamins
00780 Biotin metabolism
BSK21_07785
09110 Biosynthesis of other secondary metabolites
00333 Prodigiosin biosynthesis
BSK21_07785
09180 Brite Hierarchies
09181 Protein families: metabolism
01004 Lipid biosynthesis proteins [BR:
don01004
]
BSK21_07785
Enzymes [BR:
don01000
]
1. Oxidoreductases
1.1 Acting on the CH-OH group of donors
1.1.1 With NAD+ or NADP+ as acceptor
1.1.1.100 3-oxoacyl-[acyl-carrier-protein] reductase
BSK21_07785
Lipid biosynthesis proteins [BR:
don01004
]
Fatty acid synthase
Component type
BSK21_07785
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
adh_short_C2
adh_short
KR
NAD_binding_10
Epimerase
T4SS_CagC
THF_DHG_CYH_C
Rng_hyd_C
DFP
NmrA
GDP_Man_Dehyd
Motif
Other DBs
NCBI-ProteinID:
APO86940
LinkDB
All DBs
Position
complement(1561686..1562423)
Genome browser
AA seq
245 aa
AA seq
DB search
MFDLTGKNALITGASGGIGGAIAKALHGAGATVTLSGTRQGPLDELAAELGDRVHVLTCN
LSDAAAVDALPKQAADLMGSVDILINNAGITKDNLFMRMSDDEWSSVLEVNLTSTMRLCK
GVIRGMMKARWGRIVNISSIVGATGNPGQANYAASKAGMVGMSKSIAYEVASRGITVNCV
APGFIATAMTDKLTDDQKEKINVQIPAARMGTPEEIAAAVLYLASNEAGYTTGATLHVNG
GMAML
NT seq
738 nt
NT seq
+upstream
nt +downstream
nt
atgtttgatctcacaggtaaaaacgcgctgatcacgggcgcttcgggtggtatcggtggc
gcaatcgccaaggcactccatggtgcgggcgcaacggtcactctgtcggggacccgtcag
gggcctctcgatgaactggctgcagaactgggcgaccgcgttcacgtgctgacctgtaac
ctcagcgatgcagccgccgtggatgcgctgccgaaacaagccgctgatctgatgggttcg
gttgatattctgatcaacaacgctggcatcaccaaggataacctctttatgcgcatgtcc
gacgacgaatggtcgagcgtgcttgaggttaacctcacctcgaccatgcgtctgtgcaaa
ggcgtgatccgtggcatgatgaaggcgcgttggggccgcatcgtgaacatctcgtccatc
gttggcgcgacgggcaacccgggtcaggcgaactatgcggcgtccaaggcgggcatggtc
ggcatgtcgaaatccatcgcatacgaagtggcaagccgcgggatcaccgtgaactgcgtc
gcaccggggttcatcgcaaccgcaatgaccgacaaattgaccgacgatcaaaaagaaaag
atcaacgttcagatccccgccgctcgtatgggcaccccagaagagatcgcagcagcggtt
ctttatctcgcgtcgaacgaggccggttacaccacaggtgcgaccctgcacgtcaacggc
ggcatggcgatgctctaa
DBGET
integrated database retrieval system