Dipodomys ordii (Ord's kangaroo rat): 105986278 Help Entry 105986278         CDS       T07834                                  Symbol Max Name (RefSeq) protein max isoform X1   KO K04453   Max protein Organism dord  Dipodomys ordii (Ord's kangaroo rat) Pathway dord03083   Polycomb repressive complex dord04010   MAPK signaling pathway dord05200   Pathways in cancer dord05202   Transcriptional misregulation in cancer dord05222   Small cell lung cancer Brite KEGG Orthology (KO) [BR:dord00001]  09120 Genetic Information Processing   09126 Chromosome    03083 Polycomb repressive complex     105986278 (Max)  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     105986278 (Max)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     105986278 (Max)    05202 Transcriptional misregulation in cancer     105986278 (Max)   09162 Cancer: specific types    05222 Small cell lung cancer     105986278 (Max)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03000 Transcription factors [BR:dord03000]     105986278 (Max)    03036 Chromosome and associated proteins [BR:dord03036]     105986278 (Max) Transcription factors [BR:dord03000]  Eukaryotic type   Basic helix-loop-helix/leucine zipper (bHLH-ZIP)    Cell cycle controlling factors, Mad/Max     105986278 (Max) Chromosome and associated proteins [BR:dord03036]  Eukaryotic type   Histone modification proteins    Polycomb repressive complex (PRC) and associated proteins     Noncanonical PRC1 (PRC1.6)      105986278 (Max) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  HLH Filament bZIP_2 JetA bHLH_INO4 SlyX SLX9 DUF7801 bHLH_INO2 XhlA GAGA_bind Motif Other DBs NCBI-GeneID:  105986278 NCBI-ProteinID:  XP_012872554 Ensembl:  ENSDORG00000025196 UniProt:  A0A1S3F925 LinkDB All DBs Position Unknown AA seq 160 aa AA seqDB search MSDNDDIEVESDEEQPRFQSAADKRAHHNALERKRRDHIKDSFHSLRDSVPSLQGEKASR AQILDKATEYIQYMRRKNHTHQQDIDDLKRQNALLEQQVRALEKARSSAQLQTNYSSSDN SLYTNAKGSTISAFDGGSDSSSESEPEEPQSRKKLRMEAS NT seq 483 nt NT seq  +upstreamnt  +downstreamnt atgagcgataacgatgacatcgaggtggagagcgacgaagagcaaccgaggtttcaatct gcggctgacaaacgagctcatcataatgcactggaacgaaaacgtagggaccatatcaaa gacagctttcacagtttgcgggactctgtcccatcactccaaggagagaaggcatcccgg gcccaaatcctagacaaagccacagagtatatccagtatatgagaaggaaaaaccacacg caccagcaagatattgatgacctcaaacggcagaacgctcttctggagcagcaagtccgt gcactggagaaggcaaggtcaagtgctcaactgcagaccaactactcctcctcagacaac agcctctacaccaacgccaagggcagcaccatctctgccttcgatgggggctcagactcc agctcggagtcggagcctgaagagccccaaagcaggaagaaactccggatggaggccagc taa

DBGET integrated database retrieval system