Dipodomys ordii (Ord's kangaroo rat): 105986462 Help Entry 105986462         CDS       T07834                                  Symbol Il10 Name (RefSeq) interleukin-10   KO K05443   interleukin 10 Organism dord  Dipodomys ordii (Ord's kangaroo rat) Pathway dord04060   Cytokine-cytokine receptor interaction dord04061   Viral protein interaction with cytokine and cytokine receptor dord04068   FoxO signaling pathway dord04148   Efferocytosis dord04625   C-type lectin receptor signaling pathway dord04630   JAK-STAT signaling pathway dord04660   T cell receptor signaling pathway dord04672   Intestinal immune network for IgA production dord05133   Pertussis dord05135   Yersinia infection dord05140   Leishmaniasis dord05142   Chagas disease dord05143   African trypanosomiasis dord05144   Malaria dord05145   Toxoplasmosis dord05146   Amoebiasis dord05150   Staphylococcus aureus infection dord05152   Tuberculosis dord05310   Asthma dord05320   Autoimmune thyroid disease dord05321   Inflammatory bowel disease dord05322   Systemic lupus erythematosus dord05330   Allograft rejection Brite KEGG Orthology (KO) [BR:dord00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     105986462 (Il10)    04068 FoxO signaling pathway     105986462 (Il10)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     105986462 (Il10)    04061 Viral protein interaction with cytokine and cytokine receptor     105986462 (Il10)  09140 Cellular Processes   09141 Transport and catabolism    04148 Efferocytosis     105986462 (Il10)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     105986462 (Il10)    04660 T cell receptor signaling pathway     105986462 (Il10)    04672 Intestinal immune network for IgA production     105986462 (Il10)  09160 Human Diseases   09171 Infectious disease: bacterial    05135 Yersinia infection     105986462 (Il10)    05133 Pertussis     105986462 (Il10)    05150 Staphylococcus aureus infection     105986462 (Il10)    05152 Tuberculosis     105986462 (Il10)   09174 Infectious disease: parasitic    05146 Amoebiasis     105986462 (Il10)    05144 Malaria     105986462 (Il10)    05145 Toxoplasmosis     105986462 (Il10)    05140 Leishmaniasis     105986462 (Il10)    05142 Chagas disease     105986462 (Il10)    05143 African trypanosomiasis     105986462 (Il10)   09163 Immune disease    05310 Asthma     105986462 (Il10)    05322 Systemic lupus erythematosus     105986462 (Il10)    05320 Autoimmune thyroid disease     105986462 (Il10)    05321 Inflammatory bowel disease     105986462 (Il10)    05330 Allograft rejection     105986462 (Il10)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:dord04052]     105986462 (Il10)    00536 Glycosaminoglycan binding proteins [BR:dord00536]     105986462 (Il10) Cytokines and neuropeptides [BR:dord04052]  Cytokines   Interleukins    105986462 (Il10) Glycosaminoglycan binding proteins [BR:dord00536]  Heparan sulfate / Heparin   Cytokines    105986462 (Il10) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  IL10 IL22 Motif Other DBs NCBI-GeneID:  105986462 NCBI-ProteinID:  XP_012872823 Ensembl:  ENSDORG00000011288 UniProt:  A0A1S3F834 LinkDB All DBs Position Unknown AA seq 178 aa AA seqDB search MHSSALLCCLVLLARVVVSQGEDTQSENNCTLFPAGLPHMLRELRAAFGRVKTYFQTRDQ LDSMLLSQSLLEDFKGYLGCQALSEMIQFYLLEVMPQAENQGPDIMEHVNSLGEKLKVLR SRLRRCHRFLPCENKSKAVEQVKSAFSKLQEKGIYKAMSEFDIFINYIEAYMTMKLNN NT seq 537 nt NT seq  +upstreamnt  +downstreamnt atgcacagctcagcactgctttgttgcctggtcttactggctagagtagtggtcagtcaa ggtgaagatacccagtctgaaaataactgcaccctcttcccagctggcctgccacacatg ctccgagagctccgagctgcctttggcagggtgaagacatacttccaaacaagggatcag ctggacagcatgctgttaagccagtccctgctggaggacttcaagggttacctgggttgc caagccttgtcagagatgatccagttttacttgctggaagtgatgccccaggcagagaac cagggtccagacatcatggaacatgtaaactccctgggagagaagctgaaggttctccgg tcacggctgcgacgctgtcatcgatttcttccctgtgaaaataagagcaaggcagtggag caggtgaagagcgcatttagtaagctccaagagaaaggcatctacaaagccatgagtgag tttgacatctttatcaactacatagaagcctacatgacaatgaagctaaacaactaa

DBGET integrated database retrieval system