Dipodomys ordii (Ord's kangaroo rat): 105986734 Help Entry 105986734         CDS       T07834                                  Symbol Fos Name (RefSeq) proto-oncogene c-Fos   KO K04379   proto-oncogene protein c-fos Organism dord  Dipodomys ordii (Ord's kangaroo rat) Pathway dord01522   Endocrine resistance dord04010   MAPK signaling pathway dord04024   cAMP signaling pathway dord04210   Apoptosis dord04380   Osteoclast differentiation dord04620   Toll-like receptor signaling pathway dord04657   IL-17 signaling pathway dord04658   Th1 and Th2 cell differentiation dord04659   Th17 cell differentiation dord04660   T cell receptor signaling pathway dord04662   B cell receptor signaling pathway dord04668   TNF signaling pathway dord04713   Circadian entrainment dord04725   Cholinergic synapse dord04728   Dopaminergic synapse dord04915   Estrogen signaling pathway dord04917   Prolactin signaling pathway dord04921   Oxytocin signaling pathway dord04926   Relaxin signaling pathway dord04928   Parathyroid hormone synthesis, secretion and action dord04932   Non-alcoholic fatty liver disease dord04935   Growth hormone synthesis, secretion and action dord05031   Amphetamine addiction dord05132   Salmonella infection dord05133   Pertussis dord05135   Yersinia infection dord05140   Leishmaniasis dord05142   Chagas disease dord05161   Hepatitis B dord05162   Measles dord05166   Human T-cell leukemia virus 1 infection dord05167   Kaposi sarcoma-associated herpesvirus infection dord05170   Human immunodeficiency virus 1 infection dord05171   Coronavirus disease - COVID-19 dord05200   Pathways in cancer dord05207   Chemical carcinogenesis - receptor activation dord05208   Chemical carcinogenesis - reactive oxygen species dord05210   Colorectal cancer dord05224   Breast cancer dord05231   Choline metabolism in cancer dord05235   PD-L1 expression and PD-1 checkpoint pathway in cancer dord05323   Rheumatoid arthritis dord05417   Lipid and atherosclerosis dord05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:dord00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     105986734 (Fos)    04668 TNF signaling pathway     105986734 (Fos)    04024 cAMP signaling pathway     105986734 (Fos)  09140 Cellular Processes   09143 Cell growth and death    04210 Apoptosis     105986734 (Fos)  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     105986734 (Fos)    04660 T cell receptor signaling pathway     105986734 (Fos)    04658 Th1 and Th2 cell differentiation     105986734 (Fos)    04659 Th17 cell differentiation     105986734 (Fos)    04657 IL-17 signaling pathway     105986734 (Fos)    04662 B cell receptor signaling pathway     105986734 (Fos)   09152 Endocrine system    04915 Estrogen signaling pathway     105986734 (Fos)    04917 Prolactin signaling pathway     105986734 (Fos)    04921 Oxytocin signaling pathway     105986734 (Fos)    04926 Relaxin signaling pathway     105986734 (Fos)    04935 Growth hormone synthesis, secretion and action     105986734 (Fos)    04928 Parathyroid hormone synthesis, secretion and action     105986734 (Fos)   09156 Nervous system    04725 Cholinergic synapse     105986734 (Fos)    04728 Dopaminergic synapse     105986734 (Fos)   09158 Development and regeneration    04380 Osteoclast differentiation     105986734 (Fos)   09159 Environmental adaptation    04713 Circadian entrainment     105986734 (Fos)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     105986734 (Fos)    05207 Chemical carcinogenesis - receptor activation     105986734 (Fos)    05208 Chemical carcinogenesis - reactive oxygen species     105986734 (Fos)    05231 Choline metabolism in cancer     105986734 (Fos)    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     105986734 (Fos)   09162 Cancer: specific types    05210 Colorectal cancer     105986734 (Fos)    05224 Breast cancer     105986734 (Fos)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     105986734 (Fos)    05170 Human immunodeficiency virus 1 infection     105986734 (Fos)    05161 Hepatitis B     105986734 (Fos)    05171 Coronavirus disease - COVID-19     105986734 (Fos)    05162 Measles     105986734 (Fos)    05167 Kaposi sarcoma-associated herpesvirus infection     105986734 (Fos)   09171 Infectious disease: bacterial    05132 Salmonella infection     105986734 (Fos)    05135 Yersinia infection     105986734 (Fos)    05133 Pertussis     105986734 (Fos)   09174 Infectious disease: parasitic    05140 Leishmaniasis     105986734 (Fos)    05142 Chagas disease     105986734 (Fos)   09163 Immune disease    05323 Rheumatoid arthritis     105986734 (Fos)   09165 Substance dependence    05031 Amphetamine addiction     105986734 (Fos)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     105986734 (Fos)    05418 Fluid shear stress and atherosclerosis     105986734 (Fos)   09167 Endocrine and metabolic disease    04932 Non-alcoholic fatty liver disease     105986734 (Fos)   09176 Drug resistance: antineoplastic    01522 Endocrine resistance     105986734 (Fos)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03000 Transcription factors [BR:dord03000]     105986734 (Fos)    04131 Membrane trafficking [BR:dord04131]     105986734 (Fos) Transcription factors [BR:dord03000]  Eukaryotic type   Basic leucine zipper (bZIP)    AP-1(-like) components, Fos     105986734 (Fos) Membrane trafficking [BR:dord04131]  Autophagy   Chaperone mediated autophagy (CMA)    Selective cargos     105986734 (Fos) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  bZIP_1 bZIP_2 bZIP_Maf MIC19_MIC25 DUF3450 HALZ Macoilin Motif Other DBs NCBI-GeneID:  105986734 NCBI-ProteinID:  XP_012873267 Ensembl:  ENSDORG00000024479 UniProt:  A0A1S3FBG0 LinkDB All DBs Position Unknown AA seq 380 aa AA seqDB search MMFSGFNADYEAASSRCSSASPAGDSLSYYHSPADSFSSMGSPVNAQDFCTDLAVSSANF IPTVTAISTSPDLQWLVQPTLVSSVAPSQTRAPHPYGVPTPSAGAYSRAGVVKTMSGGRA QSIGRRGKVEQLSPEEEEKRRIRRERNKMAAAKCRNRRRELTDTLQAETDQLEDEKSALQ TEIANLLKEKEKLEFILAAHRPACKIPDDLGFPEEMTVASLDLSGTLPEATTPDSEEAFT LPLLNDPEPKASVEPVKSISSMELKAEPFDEFLFPASSRPSGSETARSVPDMDLSGSFYA ADWEPLHSGSLGMGPMATELEPLCTPVVTCTPSCTTYTSSFVFTYPEADSFPSCAAAHRK GSSSNEPSSDSLSSPTLLAL NT seq 1143 nt NT seq  +upstreamnt  +downstreamnt atgatgttctccggcttcaacgcggactacgaggcggcgtcctcgcgctgcagcagcgcg tccccggccggggacagcctctcttactaccactcacccgccgactccttctccagcatg ggctctccggtcaatgcgcaggacttctgcacggatctggctgtctccagtgccaacttc attcccacggtgactgctatctccaccagcccggatctgcagtggctggtgcagcccacc ttggtctcttctgtggccccgtcgcagacaagagccccacacccttacggagtccccacc ccctcggccggggcttactccagggctggagtggtgaagaccatgtcaggaggcagagct cagagcatcggccggaggggcaaggtagaacagttatctcctgaagaagaggagaaaagg agaatccgaagggaaagaaataagatggctgcagctaaatgccgaaaccggaggagggag ctgactgatactctgcaagcggagacagaccaactcgaagatgagaagtctgccttgcag actgagatagccaacctgctgaaggagaaggaaaaactggagttcatcctggcagctcac cgacctgcctgcaagatccctgatgacctaggcttccctgaagagatgacagtggcatcc ctggatttgagcgggaccctgccagaagccaccactccagattccgaggaagccttcacc ctgcctcttctcaatgaccctgagcccaaggcttcagtggagccggtcaagagcatcagc agcatggagctgaaggctgagcccttcgatgaattcctattcccagcatcatctaggccc agtggctccgagaccgcccgctctgtgccagacatggacctgtctggttccttctatgca gcagactgggagcccctgcacagtggctccctggggatggggcccatggccacagagctg gagcccctgtgcacccccgtggtcacttgtactcctagctgcactacttacacgtcttcc tttgtcttcacctaccctgaggctgactccttccccagctgtgcagctgcccaccgcaag ggcagcagcagcaacgagccctcctctgactcgctcagctcacccacactgctggccctg tga

DBGET integrated database retrieval system