Dipodomys ordii (Ord's kangaroo rat): 105988975 Help Entry 105988975         CDS       T07834                                  Symbol Ifnb1 Name (RefSeq) interferon beta   KO K05415   interferon beta Organism dord  Dipodomys ordii (Ord's kangaroo rat) Pathway dord04060   Cytokine-cytokine receptor interaction dord04151   PI3K-Akt signaling pathway dord04217   Necroptosis dord04380   Osteoclast differentiation dord04620   Toll-like receptor signaling pathway dord04621   NOD-like receptor signaling pathway dord04622   RIG-I-like receptor signaling pathway dord04623   Cytosolic DNA-sensing pathway dord04630   JAK-STAT signaling pathway dord04650   Natural killer cell mediated cytotoxicity dord04668   TNF signaling pathway dord04936   Alcoholic liver disease dord05135   Yersinia infection dord05142   Chagas disease dord05152   Tuberculosis dord05160   Hepatitis C dord05161   Hepatitis B dord05162   Measles dord05163   Human cytomegalovirus infection dord05164   Influenza A dord05165   Human papillomavirus infection dord05167   Kaposi sarcoma-associated herpesvirus infection dord05168   Herpes simplex virus 1 infection dord05169   Epstein-Barr virus infection dord05170   Human immunodeficiency virus 1 infection dord05171   Coronavirus disease - COVID-19 dord05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:dord00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     105988975 (Ifnb1)    04668 TNF signaling pathway     105988975 (Ifnb1)    04151 PI3K-Akt signaling pathway     105988975 (Ifnb1)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     105988975 (Ifnb1)  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     105988975 (Ifnb1)  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     105988975 (Ifnb1)    04621 NOD-like receptor signaling pathway     105988975 (Ifnb1)    04622 RIG-I-like receptor signaling pathway     105988975 (Ifnb1)    04623 Cytosolic DNA-sensing pathway     105988975 (Ifnb1)    04650 Natural killer cell mediated cytotoxicity     105988975 (Ifnb1)   09158 Development and regeneration    04380 Osteoclast differentiation     105988975 (Ifnb1)  09160 Human Diseases   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     105988975 (Ifnb1)    05161 Hepatitis B     105988975 (Ifnb1)    05160 Hepatitis C     105988975 (Ifnb1)    05171 Coronavirus disease - COVID-19     105988975 (Ifnb1)    05164 Influenza A     105988975 (Ifnb1)    05162 Measles     105988975 (Ifnb1)    05168 Herpes simplex virus 1 infection     105988975 (Ifnb1)    05163 Human cytomegalovirus infection     105988975 (Ifnb1)    05167 Kaposi sarcoma-associated herpesvirus infection     105988975 (Ifnb1)    05169 Epstein-Barr virus infection     105988975 (Ifnb1)    05165 Human papillomavirus infection     105988975 (Ifnb1)   09171 Infectious disease: bacterial    05135 Yersinia infection     105988975 (Ifnb1)    05152 Tuberculosis     105988975 (Ifnb1)   09174 Infectious disease: parasitic    05142 Chagas disease     105988975 (Ifnb1)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     105988975 (Ifnb1)   09167 Endocrine and metabolic disease    04936 Alcoholic liver disease     105988975 (Ifnb1)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:dord04052]     105988975 (Ifnb1) Cytokines and neuropeptides [BR:dord04052]  Cytokines   Interferons    105988975 (Ifnb1) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Interferon DUF3487 DUF1664 DUF1137 Motif Other DBs NCBI-GeneID:  105988975 NCBI-ProteinID:  XP_012876218 UniProt:  A0A1S3FHZ2 LinkDB All DBs Position Unknown AA seq 205 aa AA seqDB search MPSEPLLHHTGVGNTVPAFTMINGFLYQIVLLLSFTSMALFKSCSLLQLQQSSLACQKLL AQLTGRPEHCLDDRMDFKLPEEIKNLQQSQKVDTSFVVYEMLKNIFEIFRKDTSNTGWDV AIIKKLFTELNQQLDRLEKILERKIEEENLTWGNVRTFLRLKSYYWNIVRYLKNKEYSIC AWTIVQVEILRNFSFINSLTEGLEN NT seq 618 nt NT seq  +upstreamnt  +downstreamnt atgccttcagagcctttgctccatcacacaggtgtaggcaacactgttccagccttcaca atgatcaacgggtttctttaccagatagtgctcctgctgagcttcacctccatggctctt ttcaagagctgcagcttgcttcaactccagcaaagcagtttggcatgccagaagcttctg gcacaattgactggaaggcctgaacattgccttgatgacagaatggacttcaagttacct gaagagattaagaacctgcaacagtctcaaaaggtagacactagctttgtcgtctatgaa atgttgaagaacatctttgaaattttcagaaaggatacttcgaacactggatgggatgtg gccatcatcaagaagcttttcactgaacttaatcagcagctggaccgtctggagaaaatt ctggaaagaaaaatagaagaggaaaatttaacctggggaaatgtaaggacctttctgcgg ctgaagagctattattggaatattgtgagatacttgaagaacaaggaatacagcatctgt gcctggacaatagtccaagtggaaatcctcaggaacttttctttcataaacagtcttaca gagggcttggagaactga

DBGET integrated database retrieval system