Dipodomys ordii (Ord's kangaroo rat): 105989243 Help Entry 105989243         CDS       T07834                                  Symbol Igf2 Name (RefSeq) insulin-like growth factor II   KO K13769   insulin-like growth factor 2 Organism dord  Dipodomys ordii (Ord's kangaroo rat) Pathway dord04010   MAPK signaling pathway dord04014   Ras signaling pathway dord04081   Hormone signaling dord04151   PI3K-Akt signaling pathway dord05200   Pathways in cancer dord05205   Proteoglycans in cancer dord05225   Hepatocellular carcinoma Brite KEGG Orthology (KO) [BR:dord00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     105989243 (Igf2)    04014 Ras signaling pathway     105989243 (Igf2)    04151 PI3K-Akt signaling pathway     105989243 (Igf2)   09133 Signaling molecules and interaction    04081 Hormone signaling     105989243 (Igf2)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     105989243 (Igf2)    05205 Proteoglycans in cancer     105989243 (Igf2)   09162 Cancer: specific types    05225 Hepatocellular carcinoma     105989243 (Igf2)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:dord04052]     105989243 (Igf2)    00536 Glycosaminoglycan binding proteins [BR:dord00536]     105989243 (Igf2) Cytokines and neuropeptides [BR:dord04052]  Cytokines   Growth factors (RTK binding)    105989243 (Igf2) Glycosaminoglycan binding proteins [BR:dord00536]  Heparan sulfate / Heparin   Growth factors/receptors    105989243 (Igf2) SSDB OrthologParalogGFIT Motif Pfam:  IGF2_C Insulin Motif Other DBs NCBI-GeneID:  105989243 NCBI-ProteinID:  XP_012876618 Ensembl:  ENSDORG00000023345 UniProt:  A0A1S3FJ49 LinkDB All DBs Position Unknown AA seq 176 aa AA seqDB search MGFPMGKSMLVLLTFLAFASCCIAAYRPSETLCGGELVDTLQFVCGDRGFYFSRPASRAN RRSRGIVEECCFRSCDLALLETYCATPAKSERDVSISPTVLPDNPEYPVGKFFQRNTWKP STQRLRRGLPALLRARRGRALAKELQAFREAKRHLPPSSKGPAHGDSSPEMPNNQM NT seq 531 nt NT seq  +upstreamnt  +downstreamnt atggggttcccgatggggaagtcgatgctggtgcttctcaccttcttggcctttgcctcg tgctgcattgctgcttaccgccccagtgagaccttgtgtggcggggagctggtggacacc ctgcagtttgtctgtggtgaccgcggcttctacttcagcaggcctgcaagccgtgccaac cggcgcagccgtggcattgtcgaggagtgctgcttccgcagctgtgacctggccctcctg gagacctactgcgccacccccgccaagtctgagagggacgtgtcgatctctccgaccgtg cttccggacaaccctgaataccccgtgggcaagtttttccaacgtaacacctggaagcca tccacccagcgcctgcgcagaggcctgcctgccctcctgcgtgctcgccgggggcgcgca ctcgccaaggagctccaagcgttcagagaggccaagcgtcaccttcccccatcgtccaaa ggccctgcccacggggactcctctccggagatgcccaacaaccagatgtga

DBGET integrated database retrieval system