Dipodomys ordii (Ord's kangaroo rat): 105996721 Help Entry 105996721         CDS       T07834                                  Symbol Il4 Name (RefSeq) interleukin-4   KO K05430   interleukin 4 Organism dord  Dipodomys ordii (Ord's kangaroo rat) Pathway dord04060   Cytokine-cytokine receptor interaction dord04151   PI3K-Akt signaling pathway dord04630   JAK-STAT signaling pathway dord04640   Hematopoietic cell lineage dord04657   IL-17 signaling pathway dord04658   Th1 and Th2 cell differentiation dord04659   Th17 cell differentiation dord04660   T cell receptor signaling pathway dord04664   Fc epsilon RI signaling pathway dord04672   Intestinal immune network for IgA production dord05140   Leishmaniasis dord05200   Pathways in cancer dord05310   Asthma dord05320   Autoimmune thyroid disease dord05321   Inflammatory bowel disease dord05330   Allograft rejection Brite KEGG Orthology (KO) [BR:dord00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     105996721 (Il4)    04151 PI3K-Akt signaling pathway     105996721 (Il4)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     105996721 (Il4)  09150 Organismal Systems   09151 Immune system    04640 Hematopoietic cell lineage     105996721 (Il4)    04660 T cell receptor signaling pathway     105996721 (Il4)    04658 Th1 and Th2 cell differentiation     105996721 (Il4)    04659 Th17 cell differentiation     105996721 (Il4)    04657 IL-17 signaling pathway     105996721 (Il4)    04664 Fc epsilon RI signaling pathway     105996721 (Il4)    04672 Intestinal immune network for IgA production     105996721 (Il4)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     105996721 (Il4)   09174 Infectious disease: parasitic    05140 Leishmaniasis     105996721 (Il4)   09163 Immune disease    05310 Asthma     105996721 (Il4)    05320 Autoimmune thyroid disease     105996721 (Il4)    05321 Inflammatory bowel disease     105996721 (Il4)    05330 Allograft rejection     105996721 (Il4)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:dord04052]     105996721 (Il4)    00536 Glycosaminoglycan binding proteins [BR:dord00536]     105996721 (Il4) Cytokines and neuropeptides [BR:dord04052]  Cytokines   Interleukins    105996721 (Il4) Glycosaminoglycan binding proteins [BR:dord00536]  Heparan sulfate / Heparin   Cytokines    105996721 (Il4) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  IL4 FliS Imm71 Reb1_MybAD Motif Other DBs NCBI-GeneID:  105996721 NCBI-ProteinID:  XP_012886358 UniProt:  A0A1S3GBZ7 LinkDB All DBs Position Unknown AA seq 154 aa AA seqDB search MGLTPQLTAPLLFCLLACTTASPAHRCDDDALREIIKTLNTLSGRKTPCTELTVADIFDF AGPQNTSEMENLCRAMTVLQQTYQNGSELTQCLTRRKEHDILHHLRRLYRALYSRVTLKH CPVNDSTKSTWKHFLENLKRLMKKKYLQCGSSTF NT seq 465 nt NT seq  +upstreamnt  +downstreamnt atgggtctcaccccccagctgacggccccgctcctcttctgcctgctagcatgtacgacc gccagccctgctcacagatgcgacgacgatgccttgcgagagatcatcaaaaccctgaac acactgtcagggagaaagacgccgtgcaccgaactgactgtagcggacatctttgacttt gctggcccccagaacacatctgagatggaaaacctctgccgggctatgactgtgcttcag cagacctaccaaaacggcagtgagctgacccagtgtctgaccagacgcaaagaacacgac attctccatcatctgagaagactctacagggcgctctacagcagggtcacattgaaacac tgtcctgtgaatgactccacaaagagcacatggaaacactttttggaaaacctaaaaagg ctgatgaagaagaaatatttacagtgtggaagctcgacattttaa

DBGET integrated database retrieval system