Dipodomys ordii (Ord's kangaroo rat): 105997009 Help Entry 105997009         CDS       T07834                                  Symbol Tnf Name (RefSeq) tumor necrosis factor isoform X1   KO K03156   tumor necrosis factor superfamily, member 2 Organism dord  Dipodomys ordii (Ord's kangaroo rat) Pathway dord01523   Antifolate resistance dord04010   MAPK signaling pathway dord04060   Cytokine-cytokine receptor interaction dord04061   Viral protein interaction with cytokine and cytokine receptor dord04064   NF-kappa B signaling pathway dord04071   Sphingolipid signaling pathway dord04150   mTOR signaling pathway dord04210   Apoptosis dord04217   Necroptosis dord04350   TGF-beta signaling pathway dord04380   Osteoclast differentiation dord04612   Antigen processing and presentation dord04620   Toll-like receptor signaling pathway dord04621   NOD-like receptor signaling pathway dord04622   RIG-I-like receptor signaling pathway dord04625   C-type lectin receptor signaling pathway dord04640   Hematopoietic cell lineage dord04650   Natural killer cell mediated cytotoxicity dord04657   IL-17 signaling pathway dord04660   T cell receptor signaling pathway dord04664   Fc epsilon RI signaling pathway dord04668   TNF signaling pathway dord04920   Adipocytokine signaling pathway dord04930   Type II diabetes mellitus dord04931   Insulin resistance dord04932   Non-alcoholic fatty liver disease dord04933   AGE-RAGE signaling pathway in diabetic complications dord04936   Alcoholic liver disease dord04940   Type I diabetes mellitus dord05010   Alzheimer disease dord05014   Amyotrophic lateral sclerosis dord05020   Prion disease dord05022   Pathways of neurodegeneration - multiple diseases dord05132   Salmonella infection dord05133   Pertussis dord05134   Legionellosis dord05135   Yersinia infection dord05140   Leishmaniasis dord05142   Chagas disease dord05143   African trypanosomiasis dord05144   Malaria dord05145   Toxoplasmosis dord05146   Amoebiasis dord05152   Tuberculosis dord05160   Hepatitis C dord05161   Hepatitis B dord05163   Human cytomegalovirus infection dord05164   Influenza A dord05165   Human papillomavirus infection dord05166   Human T-cell leukemia virus 1 infection dord05168   Herpes simplex virus 1 infection dord05169   Epstein-Barr virus infection dord05170   Human immunodeficiency virus 1 infection dord05171   Coronavirus disease - COVID-19 dord05205   Proteoglycans in cancer dord05310   Asthma dord05321   Inflammatory bowel disease dord05322   Systemic lupus erythematosus dord05323   Rheumatoid arthritis dord05330   Allograft rejection dord05332   Graft-versus-host disease dord05410   Hypertrophic cardiomyopathy dord05414   Dilated cardiomyopathy dord05417   Lipid and atherosclerosis dord05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:dord00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     105997009 (Tnf)    04350 TGF-beta signaling pathway     105997009 (Tnf)    04064 NF-kappa B signaling pathway     105997009 (Tnf)    04668 TNF signaling pathway     105997009 (Tnf)    04071 Sphingolipid signaling pathway     105997009 (Tnf)    04150 mTOR signaling pathway     105997009 (Tnf)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     105997009 (Tnf)    04061 Viral protein interaction with cytokine and cytokine receptor     105997009 (Tnf)  09140 Cellular Processes   09143 Cell growth and death    04210 Apoptosis     105997009 (Tnf)    04217 Necroptosis     105997009 (Tnf)  09150 Organismal Systems   09151 Immune system    04640 Hematopoietic cell lineage     105997009 (Tnf)    04620 Toll-like receptor signaling pathway     105997009 (Tnf)    04621 NOD-like receptor signaling pathway     105997009 (Tnf)    04622 RIG-I-like receptor signaling pathway     105997009 (Tnf)    04625 C-type lectin receptor signaling pathway     105997009 (Tnf)    04650 Natural killer cell mediated cytotoxicity     105997009 (Tnf)    04612 Antigen processing and presentation     105997009 (Tnf)    04660 T cell receptor signaling pathway     105997009 (Tnf)    04657 IL-17 signaling pathway     105997009 (Tnf)    04664 Fc epsilon RI signaling pathway     105997009 (Tnf)   09152 Endocrine system    04920 Adipocytokine signaling pathway     105997009 (Tnf)   09158 Development and regeneration    04380 Osteoclast differentiation     105997009 (Tnf)  09160 Human Diseases   09161 Cancer: overview    05205 Proteoglycans in cancer     105997009 (Tnf)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     105997009 (Tnf)    05170 Human immunodeficiency virus 1 infection     105997009 (Tnf)    05161 Hepatitis B     105997009 (Tnf)    05160 Hepatitis C     105997009 (Tnf)    05171 Coronavirus disease - COVID-19     105997009 (Tnf)    05164 Influenza A     105997009 (Tnf)    05168 Herpes simplex virus 1 infection     105997009 (Tnf)    05163 Human cytomegalovirus infection     105997009 (Tnf)    05169 Epstein-Barr virus infection     105997009 (Tnf)    05165 Human papillomavirus infection     105997009 (Tnf)   09171 Infectious disease: bacterial    05132 Salmonella infection     105997009 (Tnf)    05135 Yersinia infection     105997009 (Tnf)    05133 Pertussis     105997009 (Tnf)    05134 Legionellosis     105997009 (Tnf)    05152 Tuberculosis     105997009 (Tnf)   09174 Infectious disease: parasitic    05146 Amoebiasis     105997009 (Tnf)    05144 Malaria     105997009 (Tnf)    05145 Toxoplasmosis     105997009 (Tnf)    05140 Leishmaniasis     105997009 (Tnf)    05142 Chagas disease     105997009 (Tnf)    05143 African trypanosomiasis     105997009 (Tnf)   09163 Immune disease    05310 Asthma     105997009 (Tnf)    05322 Systemic lupus erythematosus     105997009 (Tnf)    05323 Rheumatoid arthritis     105997009 (Tnf)    05321 Inflammatory bowel disease     105997009 (Tnf)    05330 Allograft rejection     105997009 (Tnf)    05332 Graft-versus-host disease     105997009 (Tnf)   09164 Neurodegenerative disease    05010 Alzheimer disease     105997009 (Tnf)    05014 Amyotrophic lateral sclerosis     105997009 (Tnf)    05020 Prion disease     105997009 (Tnf)    05022 Pathways of neurodegeneration - multiple diseases     105997009 (Tnf)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     105997009 (Tnf)    05418 Fluid shear stress and atherosclerosis     105997009 (Tnf)    05410 Hypertrophic cardiomyopathy     105997009 (Tnf)    05414 Dilated cardiomyopathy     105997009 (Tnf)   09167 Endocrine and metabolic disease    04930 Type II diabetes mellitus     105997009 (Tnf)    04940 Type I diabetes mellitus     105997009 (Tnf)    04936 Alcoholic liver disease     105997009 (Tnf)    04932 Non-alcoholic fatty liver disease     105997009 (Tnf)    04931 Insulin resistance     105997009 (Tnf)    04933 AGE-RAGE signaling pathway in diabetic complications     105997009 (Tnf)   09176 Drug resistance: antineoplastic    01523 Antifolate resistance     105997009 (Tnf)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:dord04052]     105997009 (Tnf)    00536 Glycosaminoglycan binding proteins [BR:dord00536]     105997009 (Tnf) Cytokines and neuropeptides [BR:dord04052]  Cytokines   Tumor necrosis fators    105997009 (Tnf) Glycosaminoglycan binding proteins [BR:dord00536]  Heparan sulfate / Heparin   Cytokines    105997009 (Tnf) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  TNF Motif Other DBs NCBI-GeneID:  105997009 NCBI-ProteinID:  XP_012886731 UniProt:  A0A1S3GD31 LinkDB All DBs Position Unknown AA seq 234 aa AA seqDB search MSTESMIQDMELAEETLPKKLSSQRSRRYLCLSLFSFLLVAGATTLFCLLHFGVIGPQRE EMYQNGLPSINPLAHTLELRSSSQMASDKPVAHVVADQRVQEQLQWLSRRANALLANGME LIDNHLVVPSNGLYLVYSQVLFKGRGCSSFLVLTHTVGRFATSYPEKVNLLSAIKSPCQK EIPEGPELKPWYEPIYLGGVFQLEKGDRLSAEVNLPQYLDFAEAGQVYFGIIAL NT seq 705 nt NT seq  +upstreamnt  +downstreamnt atgagcactgaaagcatgatccaggacatggaactggcagaggagacactgcccaagaag ctaagctcccagaggtccagaaggtatctgtgcctcagcctcttctccttcctgcttgtg gcaggagccaccacgcttttctgcctgttgcacttcggagtgatcggcccccagcgagaa gagatgtaccagaatggcctccctagcatcaatccactggcccataccctcgaacttaga tcctcttctcaaatggcaagtgacaagcctgtagcccatgtcgtagcggaccaacgagtg caagagcagctgcagtggctgagccgacgtgccaatgccctgctggccaatggcatggaa ctgatagacaaccatctggtggtgccatctaacgggctgtacctcgtctactcacaagtt ctcttcaagggccgaggctgctcctctttcctcgtccttacccacaccgtcggccgcttt gccacctcctacccggaaaaagttaacctcctttctgccatcaagagcccgtgccagaag gagatcccagaggggcctgagctcaagccctggtatgagcccatttacctaggaggggtc ttccagctggaaaagggtgaccgacttagcgctgaggtcaatctgccccagtatctagac tttgccgaagccgggcaagtctactttggcatcattgccttgtga

DBGET integrated database retrieval system