Dipodomys ordii (Ord's kangaroo rat): 105998763 Help Entry 105998763         CDS       T07834                                  Name (RefSeq) CD209 antigen-like protein C   KO K06563   C-type lectin domain family 4 member L/M Organism dord  Dipodomys ordii (Ord's kangaroo rat) Pathway dord03260   Virion - Human immunodeficiency virus dord03264   Virion - Flavivirus and Alphavirus dord03265   Virion - Ebolavirus, Lyssavirus and Morbillivirus dord03273   Virion - Lassa virus and SFTS virus dord04145   Phagosome dord04625   C-type lectin receptor signaling pathway dord05152   Tuberculosis dord05162   Measles Brite KEGG Orthology (KO) [BR:dord00001]  09120 Genetic Information Processing   09125 Information processing in viruses    03260 Virion - Human immunodeficiency virus     105998763    03264 Virion - Flavivirus and Alphavirus     105998763    03265 Virion - Ebolavirus, Lyssavirus and Morbillivirus     105998763    03273 Virion - Lassa virus and SFTS virus     105998763  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     105998763  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     105998763  09160 Human Diseases   09172 Infectious disease: viral    05162 Measles     105998763   09171 Infectious disease: bacterial    05152 Tuberculosis     105998763  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:dord04131]     105998763   09183 Protein families: signaling and cellular processes    04054 Pattern recognition receptors [BR:dord04054]     105998763    04090 CD molecules [BR:dord04090]     105998763    04091 Lectins [BR:dord04091]     105998763 Membrane trafficking [BR:dord04131]  Endocytosis   Phagocytosis    C-lectin receptors     105998763 Pattern recognition receptors [BR:dord04054]  Membrane-bound pattern recognition receptors   C-type lectin receptors    105998763 CD molecules [BR:dord04090]  Proteins   105998763 Lectins [BR:dord04091]  C-Type lectins   Asialoglycoprotein and DC receptors    105998763 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Lectin_C UL45 Dopey_N Motif Other DBs NCBI-GeneID:  105998763 NCBI-ProteinID:  XP_012889009 UniProt:  A0A1S3GL94 LinkDB All DBs Position Unknown AA seq 203 aa AA seqDB search MYDPEEERRQYLGCPGQSHLLLVLHLLLITLLAGLLTAVLVPELEDPSSQGKERIYQELR QLKARVDSMCRPCPWDWMLFQQSCYFFSKSRRNWNDSVTACQEMQAQLVMIKNDEEKSFL EMISEHKHPSWIGLSDVGREGDWLWLDGSPLSQSLVKYWKKDRPNNDTEKNCAEFSADGW NDVTCDLEKYWICNKSSWPCSNK NT seq 612 nt NT seq  +upstreamnt  +downstreamnt atgtatgaccctgaggaagagaggaggcaatatctggggtgtcctggccagagtcacctt ctcctggtgctgcatctgctcttgatcacactcttggctggactgttgacggctgttctt gttccggagttggaggatcccagctcccaggggaaagagaggatctaccaggaactgaga cagctgaaggctagagtggacagcatgtgtcgcccctgcccctgggactggatgctcttc cagcagagctgttatttcttctccaagtccagacggaactggaatgattcagtcactgcc tgccaggaaatgcaggcccagctagtgatgatcaaaaatgatgaggaaaagagtttcctg gagatgatttctgagcataaacacccctcctggattggtctctcagacgtgggacgggaa ggcgattggctctggctggatggctcacctttgtcacaaagcctggtgaagtactggaag aaagataggcccaacaatgacacggagaagaactgtgcggaatttagtgctgatggttgg aatgacgtcacatgcgatctggagaaatactggatctgcaataagtcctcatggccctgc tccaacaaatga

DBGET integrated database retrieval system