Drosophila persimilis: 6593564 Help Entry 6593564           CDS       T01063                                  Name (RefSeq) GTP-binding nuclear protein Ran   KO K07936   GTP-binding nuclear protein Ran Organism dpe  Drosophila persimilis Pathway dpe03008   Ribosome biogenesis in eukaryotes dpe03013   Nucleocytoplasmic transport dpe03250   Viral life cycle - HIV-1 Brite KEGG Orthology (KO) [BR:dpe00001]  09120 Genetic Information Processing   09122 Translation    03013 Nucleocytoplasmic transport     6593564    03008 Ribosome biogenesis in eukaryotes     6593564   09125 Information processing in viruses    03250 Viral life cycle - HIV-1     6593564  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:dpe03019]     6593564    03009 Ribosome biogenesis [BR:dpe03009]     6593564    03016 Transfer RNA biogenesis [BR:dpe03016]     6593564    03036 Chromosome and associated proteins [BR:dpe03036]     6593564   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:dpe04147]     6593564    04031 GTP-binding proteins [BR:dpe04031]     6593564 Messenger RNA biogenesis [BR:dpe03019]  Eukaryotic type   mRNA surveillance and transport factors    Transport factors     Ran-mediated transport factors      6593564 Ribosome biogenesis [BR:dpe03009]  Eukaryotic type   Pre-40S particles    Export and cytoplasmic maturation factors     6593564   Pre-60S particles     6593564 Transfer RNA biogenesis [BR:dpe03016]  Eukaryotic type   tRNA transport factors    tRNA export factors     6593564 Chromosome and associated proteins [BR:dpe03036]  Eukaryotic type   Centrosome formation proteins    Centrosome duplication proteins     Regulators of centriole replication      6593564    Spindle formation proteins     6593564 Exosome [BR:dpe04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    6593564 GTP-binding proteins [BR:dpe04031]  Small (monomeric) G-proteins   Ran Family    Ran     6593564 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf AAA_14 Motif Other DBs NCBI-GeneID:  6593564 NCBI-ProteinID:  XP_002019244 UniProt:  B4GJC6 LinkDB All DBs Position Unknown AA seq 179 aa AA seqDB search MDVPTYKCIIMGEKCCGKTTFLKRHLTGEFVEEYVHTARGSTSIVTLTFNSNRGPIQFDV FDWGQENEELLLHPEDFYKDGQCAIVMFDVSSVFIFGDFFKQFLMLNLPISLCGNKADIK TDNYSVYDPENFLSSPNLEKKIFSEISVKTGLNIDQPFLYLARKLLNDFTLEFIPSTDV NT seq 540 nt NT seq  +upstreamnt  +downstreamnt atggatgtgccaacttacaagtgtattattatgggcgagaaatgctgtggcaagaccacg tttttgaaaagacatctaactggagagtttgtggaggagtatgtccacacggcgcgtgga tccaccagcattgtgacactgaccttcaacagcaatcgcggacccatacaatttgatgtg tttgactggggccaagagaatgaggagctgctactccatccagaagatttctacaaagac ggccagtgcgcgatcgtaatgtttgatgtgtcctcggtgtttatcttcggtgatttcttc aaacagtttttgatgttgaaccttccaatatccctctgtggaaacaaggcggatatcaag actgataactactctgtatatgatccagaaaactttttgagcagtcccaacttggaaaaa aaaatttttagcgaaatatcggtcaagacggggctcaatattgatcaaccgtttctttat ctggcacgcaaattgcttaacgacttcactttggagttcataccgtctacagatgtctag

DBGET integrated database retrieval system