Drosophila persimilis: 6599516 Help Entry 6599516           CDS       T01063                                  Name (RefSeq) RING-box protein 1B   KO K03868   E3 ubiquitin-protein ligase RBX1 [EC:2.3.2.32] Organism dpe  Drosophila persimilis Pathway dpe03420   Nucleotide excision repair dpe04120   Ubiquitin mediated proteolysis dpe04141   Protein processing in endoplasmic reticulum dpe04310   Wnt signaling pathway dpe04341   Hedgehog signaling pathway - fly dpe04350   TGF-beta signaling pathway Brite KEGG Orthology (KO) [BR:dpe00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     6599516    04120 Ubiquitin mediated proteolysis     6599516   09124 Replication and repair    03420 Nucleotide excision repair     6599516  09130 Environmental Information Processing   09132 Signal transduction    04310 Wnt signaling pathway     6599516    04341 Hedgehog signaling pathway - fly     6599516    04350 TGF-beta signaling pathway     6599516  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:dpe04121]     6599516    03400 DNA repair and recombination proteins [BR:dpe03400]     6599516 Enzymes [BR:dpe01000]  2. Transferases   2.3  Acyltransferases    2.3.2  Aminoacyltransferases     2.3.2.32  cullin-RING-type E3 NEDD8 transferase      6599516 Ubiquitin system [BR:dpe04121]  Ubiquitin ligases (E3)   UBL E3 ligases    6599516   Multi subunit type E3    SCF complex     Ring finger protein      6599516    Cul2 complex      6599516    Cul3 complex      6599516    Cul4 complex      6599516    Cul7 complex      6599516    Cul8 complex      6599516    Cul9 complex      6599516 DNA repair and recombination proteins [BR:dpe03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     GGR (global genome repair) factors      Cul4-DDB2 complex       6599516     TCR (transcription coupled repair) factors      Cul4-CSA complex       6599516 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  zf-rbx1 zf-ANAPC11 zf-RING_2 zf-C3HC4_2 zf-C3HC4 zf-RING_11 zf-RING_UBOX PHD_NSD Motif Other DBs NCBI-GeneID:  6599516 NCBI-ProteinID:  XP_002024644 UniProt:  B4H1B5 LinkDB All DBs Position Unknown AA seq 123 aa AA seqDB search MTDQLEDVEESTDFRDLEELNDDVPSCSGTQQYRKDRFVVNKWVAHALWSWDVTVDNCAI CRNHIMNLCIECQADPNANKDECTVAWGECNHAFHYHCIARWLKTRLVCPLDNKKWVYQK YGH NT seq 372 nt NT seq  +upstreamnt  +downstreamnt atgaccgatcagctggaagacgtagaagaatctacggacttccgtgacttagaagagtta aatgacgacgtgccctcatgcagcggcacgcagcagtacaggaaggaccggttcgtggtt aacaagtgggtggctcatgctctctggtcctgggacgtgaccgtggacaactgcgcgatc tgccgcaaccacatcatgaacctgtgcatcgagtgccaggcggatcccaatgccaacaag gacgagtgcaccgtggcctggggcgagtgcaaccacgccttccactaccattgcatcgct cgctggctgaagacgcgtctggtttgccccctggacaacaagaagtgggtctaccagaaa tacggccactaa

DBGET integrated database retrieval system