Pseudodesulfovibrio piezophilus: BN4_11611
Help
Entry
BN4_11611 CDS
T02481
Symbol
fabG
Name
(GenBank) 3-oxoacyl-[acyl-carrier-protein] reductase
KO
K00059
3-oxoacyl-[acyl-carrier protein] reductase [EC:
1.1.1.100
]
Organism
dpi
Pseudodesulfovibrio piezophilus
Pathway
dpi00061
Fatty acid biosynthesis
dpi00780
Biotin metabolism
dpi01100
Metabolic pathways
dpi01110
Biosynthesis of secondary metabolites
dpi01212
Fatty acid metabolism
dpi01240
Biosynthesis of cofactors
Module
dpi_M00083
Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:
dpi00001
]
09100 Metabolism
09103 Lipid metabolism
00061 Fatty acid biosynthesis
BN4_11611 (fabG)
09108 Metabolism of cofactors and vitamins
00780 Biotin metabolism
BN4_11611 (fabG)
09110 Biosynthesis of other secondary metabolites
00333 Prodigiosin biosynthesis
BN4_11611 (fabG)
09180 Brite Hierarchies
09181 Protein families: metabolism
01004 Lipid biosynthesis proteins [BR:
dpi01004
]
BN4_11611 (fabG)
Enzymes [BR:
dpi01000
]
1. Oxidoreductases
1.1 Acting on the CH-OH group of donors
1.1.1 With NAD+ or NADP+ as acceptor
1.1.1.100 3-oxoacyl-[acyl-carrier-protein] reductase
BN4_11611 (fabG)
Lipid biosynthesis proteins [BR:
dpi01004
]
Fatty acid synthase
Component type
BN4_11611 (fabG)
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
adh_short_C2
adh_short
KR
Epimerase
SDR
NAD_binding_10
LytR_C
DUF7234
DNA_Packaging_2
F420_oxidored
Motif
Other DBs
NCBI-ProteinID:
CCH48846
UniProt:
M1WK22
LinkDB
All DBs
Position
complement(1677768..1678511)
Genome browser
AA seq
247 aa
AA seq
DB search
MSDLPKVALVTGGSRGIGRTIAERLAAEGFEVYLTYVSRPEEADKVVAAIAHNGGKAKAF
QLDSGDRDAIADFFKTEIKGKANLEVLVNNAGITRDGLMMRMKDDDWDKVIQINLTGCFS
FLKEASKIMGKQRSGRIINITSIVGQMGNAGQANYCSAKAGLIGLTKSAARELAGRGITV
NAVAPGFIETDMTAELPEKVVEAMLAQIPLKSLGQSEDIAAAVAFLAGPGAGYITGQVLG
VNGGMYM
NT seq
744 nt
NT seq
+upstream
nt +downstream
nt
atgagtgatcttcctaaagtcgcgctggtcacgggtggttcccgtggcataggtcgaaca
atcgccgagcgactcgctgccgagggctttgaggtctacctgacctacgtaagccgcccg
gaagaggcagacaaggtggttgcagccattgcgcataacggtggcaaggccaaggccttt
caactggactccggagatcgtgacgctattgccgattttttcaagactgagatcaaaggc
aaggcaaacctcgaagtgctggtcaataacgcgggcatcactcgcgatggcctgatgatg
cgtatgaaggatgatgactgggataaggtcattcagatcaatctcaccggttgtttctcc
tttctcaaggaagcgtccaagattatgggcaagcaacgttccgggcgtatcatcaacatt
accagcatcgtcggccagatggggaatgccggtcaggccaattattgttccgccaaggca
ggtcttataggcctgaccaagtccgcagctcgtgagctggcagggcgtgggatcacggtc
aatgccgtggctcccggcttcattgagaccgatatgacagccgaattgcctgaaaaggtc
gtcgaagccatgttggcacagatcccgttaaaatccctcgggcagtccgaggatatcgca
gccgcagtcgcctttctggccggtcccggagcagggtatattaccggacaggtcttgggc
gttaatggcggtatgtacatgtaa
DBGET
integrated database retrieval system