Drosophila pseudoobscura: 4815193 Help Entry 4815193           CDS       T01032                                  Name (RefSeq) GTP-binding nuclear protein Ran   KO K07936   GTP-binding nuclear protein Ran Organism dpo  Drosophila pseudoobscura Pathway dpo03008   Ribosome biogenesis in eukaryotes dpo03013   Nucleocytoplasmic transport dpo03250   Viral life cycle - HIV-1 Brite KEGG Orthology (KO) [BR:dpo00001]  09120 Genetic Information Processing   09122 Translation    03013 Nucleocytoplasmic transport     4815193    03008 Ribosome biogenesis in eukaryotes     4815193   09125 Information processing in viruses    03250 Viral life cycle - HIV-1     4815193  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:dpo03019]     4815193    03009 Ribosome biogenesis [BR:dpo03009]     4815193    03016 Transfer RNA biogenesis [BR:dpo03016]     4815193    03036 Chromosome and associated proteins [BR:dpo03036]     4815193   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:dpo04147]     4815193    04031 GTP-binding proteins [BR:dpo04031]     4815193 Messenger RNA biogenesis [BR:dpo03019]  Eukaryotic type   mRNA surveillance and transport factors    Transport factors     Ran-mediated transport factors      4815193 Ribosome biogenesis [BR:dpo03009]  Eukaryotic type   Pre-40S particles    Export and cytoplasmic maturation factors     4815193   Pre-60S particles     4815193 Transfer RNA biogenesis [BR:dpo03016]  Eukaryotic type   tRNA transport factors    tRNA export factors     4815193 Chromosome and associated proteins [BR:dpo03036]  Eukaryotic type   Centrosome formation proteins    Centrosome duplication proteins     Regulators of centriole replication      4815193    Spindle formation proteins     4815193 Exosome [BR:dpo04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    4815193 GTP-binding proteins [BR:dpo04031]  Small (monomeric) G-proteins   Ran Family    Ran     4815193 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf MMR_HSR1 GTP_EFTU RNA_helicase Gtr1_RagA AAA_24 ArgoMid AAA_7 DUF5935 DUF5906 DAP3 AAA_16 Motif Other DBs NCBI-GeneID:  4815193 NCBI-ProteinID:  XP_001354693 UniProt:  Q29HL0 LinkDB All DBs Position X:15096455..15100136 Genome browser AA seq 216 aa AA seqDB search MAQEGQDIPTFKCVLVGDGGTGKTTFVKRHMTGEFEKKYVATLGVEVHPLIFHTNRGAIR FNVWDTAGQEKFGGLRDGYYIQGQCAVVMFDVTSRVTYKNVPNWHRDLVRVCENIPIVLC GNKVDIKDRKVKAKSIVFHRKKNLQYYDISAKSNYNFEKPFLWLARKLVGDPNLEFVAMP ALLPPEVKMDKDWQLQIERDLQEAQATALPDEDEDL NT seq 651 nt NT seq  +upstreamnt  +downstreamnt atggctcaagaaggtcaagatataccaacttttaagtgcgtgctggttggagatggcggt actggcaagaccacgttcgtcaaacgccatatgactggcgagttcgaaaagaagtatgtg gccacattgggcgtggaagtccatcctttgatcttccacaccaatcgtggtgccatccgt ttcaacgtctgggatacagccggacaagagaaattcggcggtctgcgtgatgggtactat attcaaggacagtgcgccgttgttatgttcgatgtgacctcccgagttacatacaagaat gtacccaactggcacagagatttggtgcgtgtctgcgagaacattccaatagttctctgc ggcaacaaggtggacatcaaggaccgcaaagtcaaggccaaaagcattgtctttcatcgt aaaaagaacctccagtattacgacatttcggccaagtcaaactacaatttcgaaaaacca ttcctctggctggcacgcaaattggttggtgatcccaacctagagttcgttgccatgccg gcactgctgccgccagaggtgaaaatggacaaggactggcagctgcagatcgagcgtgac ttgcaggaggcccaggcgaccgccttgcccgatgaggatgaggatctttaa

DBGET integrated database retrieval system