Drosophila pseudoobscura: 6901854 Help Entry 6901854           CDS       T01032                                  Name (RefSeq) RING-box protein 1A   KO K03868   E3 ubiquitin-protein ligase RBX1 [EC:2.3.2.32] Organism dpo  Drosophila pseudoobscura Pathway dpo03420   Nucleotide excision repair dpo04120   Ubiquitin mediated proteolysis dpo04141   Protein processing in endoplasmic reticulum dpo04310   Wnt signaling pathway dpo04341   Hedgehog signaling pathway - fly dpo04350   TGF-beta signaling pathway Brite KEGG Orthology (KO) [BR:dpo00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     6901854    04120 Ubiquitin mediated proteolysis     6901854   09124 Replication and repair    03420 Nucleotide excision repair     6901854  09130 Environmental Information Processing   09132 Signal transduction    04310 Wnt signaling pathway     6901854    04341 Hedgehog signaling pathway - fly     6901854    04350 TGF-beta signaling pathway     6901854  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:dpo04121]     6901854    03400 DNA repair and recombination proteins [BR:dpo03400]     6901854 Enzymes [BR:dpo01000]  2. Transferases   2.3  Acyltransferases    2.3.2  Aminoacyltransferases     2.3.2.32  cullin-RING-type E3 NEDD8 transferase      6901854 Ubiquitin system [BR:dpo04121]  Ubiquitin ligases (E3)   UBL E3 ligases    6901854   Multi subunit type E3    SCF complex     Ring finger protein      6901854    Cul2 complex      6901854    Cul3 complex      6901854    Cul4 complex      6901854    Cul7 complex      6901854    Cul8 complex      6901854    Cul9 complex      6901854 DNA repair and recombination proteins [BR:dpo03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     GGR (global genome repair) factors      Cul4-DDB2 complex       6901854     TCR (transcription coupled repair) factors      Cul4-CSA complex       6901854 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  zf-rbx1 zf-ANAPC11 zf-RING_2 zf-C3HC4 zf-C3HC4_2 zf-RING_11 zf-RING_16 Motif Other DBs NCBI-GeneID:  6901854 NCBI-ProteinID:  XP_002133392 UniProt:  B5DKH1 LinkDB All DBs Position X:22460836..22461918 Genome browser AA seq 112 aa AA seqDB search MDRNMEVDEEEFEVPSSSSKGEKKRFEVKKWNAVALWAWDIVVDNCAICRNHIMDLCIEC QANQASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNREWDFQKYGH NT seq 339 nt NT seq  +upstreamnt  +downstreamnt atggacagaaacatggaggttgacgaggaagaatttgaggtgccttccagcagtagtaag ggcgaaaagaagcgcttcgaggttaagaaatggaacgccgtagctctatgggcctgggat atcgttgttgacaattgcgccatttgccgcaaccacataatggacttgtgcatcgagtgc caggctaaccaggcctctgccaccagcgaggagtgtaccgtggcctggggcgtttgcaat cacgccttccactttcactgcatttcacgttggctgaagactcgtcaggtgtgccccttg gacaaccgcgagtgggacttccagaagtacggtcactag

DBGET integrated database retrieval system