Drosophila pseudoobscura: 6902410 Help Entry 6902410           CDS       T01032                                  Name (RefSeq) GTP-binding nuclear protein Ran   KO K07936   GTP-binding nuclear protein Ran Organism dpo  Drosophila pseudoobscura Pathway dpo03008   Ribosome biogenesis in eukaryotes dpo03013   Nucleocytoplasmic transport dpo03250   Viral life cycle - HIV-1 Brite KEGG Orthology (KO) [BR:dpo00001]  09120 Genetic Information Processing   09122 Translation    03013 Nucleocytoplasmic transport     6902410    03008 Ribosome biogenesis in eukaryotes     6902410   09125 Information processing in viruses    03250 Viral life cycle - HIV-1     6902410  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:dpo03019]     6902410    03009 Ribosome biogenesis [BR:dpo03009]     6902410    03016 Transfer RNA biogenesis [BR:dpo03016]     6902410    03036 Chromosome and associated proteins [BR:dpo03036]     6902410   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:dpo04147]     6902410    04031 GTP-binding proteins [BR:dpo04031]     6902410 Messenger RNA biogenesis [BR:dpo03019]  Eukaryotic type   mRNA surveillance and transport factors    Transport factors     Ran-mediated transport factors      6902410 Ribosome biogenesis [BR:dpo03009]  Eukaryotic type   Pre-40S particles    Export and cytoplasmic maturation factors     6902410   Pre-60S particles     6902410 Transfer RNA biogenesis [BR:dpo03016]  Eukaryotic type   tRNA transport factors    tRNA export factors     6902410 Chromosome and associated proteins [BR:dpo03036]  Eukaryotic type   Centrosome formation proteins    Centrosome duplication proteins     Regulators of centriole replication      6902410    Spindle formation proteins     6902410 Exosome [BR:dpo04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    6902410 GTP-binding proteins [BR:dpo04031]  Small (monomeric) G-proteins   Ran Family    Ran     6902410 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf AAA_14 DUF592 Motif Other DBs NCBI-GeneID:  6902410 NCBI-ProteinID:  XP_002133344 UniProt:  A0A6I8UZ74 LinkDB All DBs Position 4:complement(15835231..15836223) Genome browser AA seq 182 aa AA seqDB search MDVPTYKCIIIGEKRCGKTTFLRRHLTGEFKSEYFPTDKNSVNIDTLIFSSNRGPIRFDV WDWGKEDEELGRYPDDFYSNSHCAIIMFDASSVDLFQNFHKFMTLNKICPGIPISICGNK SDIKPGSDFPLNPAHRLCKISVKTGLNMDGPFLYLARKLFNDFTLEFVKLPPLVFPQPGC VS NT seq 549 nt NT seq  +upstreamnt  +downstreamnt atggatgtgccaacttacaagtgcattattattggcgagaaacgctgtggcaaaaccacg tttttgagacgccatctaactggagaatttaagagcgagtattttcccacggacaagaac tccgtcaacatagacacgctgatcttcagcagcaatcgcggacccattcgattcgatgtg tgggactggggcaaggaggatgaggagctgggccgctatccagatgatttctacagcaac agccactgcgcgatcataatgtttgatgcaagctcggtggatctcttccagaatttccac aagtttatgacgctgaacaagatttgtccaggcattccaatatccatctgtggaaacaag tcggatatcaagcctggatccgattttccattaaatccggcacaccgtttgtgcaaaata tcagtcaagacggggctcaatatggatggaccgtttctttatctggcccgcaaactgttt aacgacttcactttggagttcgttaaactgccaccactggtctttcctcagcctggatgc gtatcgtaa

DBGET integrated database retrieval system