Drosophila pseudoobscura: 6903274 Help Entry 6903274           CDS       T01032                                  Name (RefSeq) GTP-binding nuclear protein Ran   KO K07936   GTP-binding nuclear protein Ran Organism dpo  Drosophila pseudoobscura Pathway dpo03008   Ribosome biogenesis in eukaryotes dpo03013   Nucleocytoplasmic transport dpo03250   Viral life cycle - HIV-1 Brite KEGG Orthology (KO) [BR:dpo00001]  09120 Genetic Information Processing   09122 Translation    03013 Nucleocytoplasmic transport     6903274    03008 Ribosome biogenesis in eukaryotes     6903274   09125 Information processing in viruses    03250 Viral life cycle - HIV-1     6903274  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:dpo03019]     6903274    03009 Ribosome biogenesis [BR:dpo03009]     6903274    03016 Transfer RNA biogenesis [BR:dpo03016]     6903274    03036 Chromosome and associated proteins [BR:dpo03036]     6903274   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:dpo04147]     6903274    04031 GTP-binding proteins [BR:dpo04031]     6903274 Messenger RNA biogenesis [BR:dpo03019]  Eukaryotic type   mRNA surveillance and transport factors    Transport factors     Ran-mediated transport factors      6903274 Ribosome biogenesis [BR:dpo03009]  Eukaryotic type   Pre-40S particles    Export and cytoplasmic maturation factors     6903274   Pre-60S particles     6903274 Transfer RNA biogenesis [BR:dpo03016]  Eukaryotic type   tRNA transport factors    tRNA export factors     6903274 Chromosome and associated proteins [BR:dpo03036]  Eukaryotic type   Centrosome formation proteins    Centrosome duplication proteins     Regulators of centriole replication      6903274    Spindle formation proteins     6903274 Exosome [BR:dpo04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    6903274 GTP-binding proteins [BR:dpo04031]  Small (monomeric) G-proteins   Ran Family    Ran     6903274 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc ORC-CDC6-like Motif Other DBs NCBI-GeneID:  6903274 NCBI-ProteinID:  XP_002132973 UniProt:  A0A6I8UXY4 LinkDB All DBs Position 4:complement(29514886..29515811) Genome browser AA seq 195 aa AA seqDB search MNRNMPRFNCAILGDRGTGKTSFINRHLSGEFSDGGAAAERESHELVFHTNRGPMCFVVW ETHGELKGKPECAIVLFDVTSKTSCKNVVEWKTAFAKASRFQGAVIVCGNKVDLQHRYGQ GPEFRNGRYDISVKKDYNLGKPFLWLARSLVGDPQLRFVPQPAPPPPQPPLDDAAKREMD FNLIVAEIVPLPGSV NT seq 588 nt NT seq  +upstreamnt  +downstreamnt atgaataggaacatgccacggtttaactgcgcgattcttggcgatagaggcactggcaaa acgtccttcatcaaccgccacctgagtggggagttcagcgacggcggtgctgcagcggaa cgcgaaagccacgagcttgtcttccacaccaatcgcggccccatgtgcttcgtggtgtgg gagacccacggcgagctgaaggggaagccggagtgcgccatagtcctgttcgacgtcact tcgaagacgtcgtgcaaaaacgttgtcgaatggaaaacggctttcgccaaggccagccgt ttccaaggagccgtgatcgtctgcggaaataaggtggacctgcagcatcgctacggccaa ggccccgagttcagaaatggccgctacgatatatcggtgaagaaggactacaatttgggg aagcccttcctgtggctggcgcgcagcctcgttggcgatccacaactgaggtttgtgccc caaccagcccccccgccgccacagccgccactggacgacgccgccaagcgggagatggat tttaacttgatagtcgcggagatagtaccccttccaggcagcgtttaa

DBGET integrated database retrieval system