KEGG   Deinococcus proteolyticus: Deipr_1797
Entry
Deipr_1797        CDS       T01426                                 
Name
(GenBank) 3-oxoacyl-(acyl-carrier-protein) reductase
  KO
K00059  3-oxoacyl-[acyl-carrier protein] reductase [EC:1.1.1.100]
Organism
dpt  Deinococcus proteolyticus
Pathway
dpt00061  Fatty acid biosynthesis
dpt00780  Biotin metabolism
dpt01100  Metabolic pathways
dpt01110  Biosynthesis of secondary metabolites
dpt01212  Fatty acid metabolism
dpt01240  Biosynthesis of cofactors
Module
dpt_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:dpt00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    Deipr_1797
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    Deipr_1797
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    Deipr_1797
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:dpt01004]
    Deipr_1797
Enzymes [BR:dpt01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.100  3-oxoacyl-[acyl-carrier-protein] reductase
     Deipr_1797
Lipid biosynthesis proteins [BR:dpt01004]
 Fatty acid synthase
  Component type
   Deipr_1797
SSDB
Motif
Pfam: adh_short_C2 adh_short KR Epimerase SDR DUF1776 LytR_C
Other DBs
NCBI-ProteinID: ADY26929
UniProt: F0RLK5
LinkDB
Position
complement(1915628..1916377)
AA seq 249 aa
MTESQKKIALVTGSSRGLGRAMALKLAADGYAVAVHYGRGQEQAEGVAEQIRAAGGQAQT
FGADLSDPANAAALVEQVIKDMGGLDVLVNNAGITRDGLAVRMKDEDWHAVIQTNLSSAF
AASRAAIKHMMRAKTGRIINITSVVALSGNPGQANYVASKAGLIGLTKALAKEYGGRGIT
VNAVAPGFIESDMTADLGSDLRAEYERNIPLGRMGQPEEVAALVAFLASDGASYISGQII
GVDGGMNPH
NT seq 750 nt   +upstreamnt  +downstreamnt
atgacggaatcgcagaagaaaatcgctctggtaaccggctccagccggggcctgggccgc
gctatggcgctgaagctggccgcagacggctacgcggtggccgtgcactacggacgcggg
caggagcaggccgaaggggtggcagagcagattcgcgccgccggtggacaggcgcagacc
ttcggggccgacctgtccgacccggccaatgctgcggcactggtggagcaggtcatcaaa
gacatgggcggcctggacgtgctggtcaacaatgccgggattacccgcgacggtctggcg
gtccgcatgaaggacgaggactggcacgcggtcatccagaccaacctcagcagcgctttt
gcggccagccgcgccgccatcaagcacatgatgcgggccaaaactgggcgcatcatcaac
atcacgtccgtggtggcgctgagcggcaacccaggccaggccaactatgtcgccagcaaa
gcgggcctgattgggctgaccaaggccctcgccaaggagtacggcgggcgcggcatcacc
gtgaatgcggtggcccccggctttatcgagtcggacatgacggcggacctcgggagcgac
ctgcgggccgagtacgagcgcaacatcccgctgggccggatggggcagccggaagaggtc
gccgcgctggtggcgttcctggcctcagacggggccagctatatctccgggcagattatc
ggggtggacgggggcatgaacccacactga

DBGET integrated database retrieval system