Dryobates pubescens (Downy woodpecker): 104297397 Help Entry 104297397         CDS       T08526                                  Symbol HYPK Name (RefSeq) huntingtin-interacting protein K   KO K28128   huntingtin-interacting protein K Organism dpub  Dryobates pubescens (Downy woodpecker) Brite KEGG Orthology (KO) [BR:dpub00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:dpub03110]     104297397 (HYPK)    03036 Chromosome and associated proteins [BR:dpub03036]     104297397 (HYPK) Chaperones and folding catalysts [BR:dpub03110]  Other chaperones and cochaperones   Others    104297397 (HYPK) Chromosome and associated proteins [BR:dpub03036]  Eukaryotic type   Sister chromatid cohesion proteins    Other sister chromatid cohesion factors     104297397 (HYPK) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  UBA_HYPK UBA_7 DUF6378 RPN6_C_helix Motif Other DBs NCBI-GeneID:  104297397 NCBI-ProteinID:  XP_009895625 LinkDB All DBs Position Unknown AA seq 66 aa AA seqDB search MDTPAWDLAAPLDRMRLWEKELAKVTIKKEDLELIMTEMEISRAAAERSLREHMGNVVEA LITLTN NT seq 201 nt NT seq  +upstreamnt  +downstreamnt atggacactcctgcctgggaccttgctgccccgctggacaggatgaggctgtgggagaag gaactggccaaagtgaccatcaagaaggaggacctagagctgatcatgacagagatggag atctcgcgggcagctgcagagcggagcctgcgggagcacatggggaacgtggtggaggct ctcatcaccctcaccaactga

DBGET integrated database retrieval system