Dryobates pubescens (Downy woodpecker): 104309372 Help Entry 104309372         CDS       T08526                                  Symbol DHFR Name (RefSeq) dihydrofolate reductase   KO K00287   dihydrofolate reductase [EC:1.5.1.3] Organism dpub  Dryobates pubescens (Downy woodpecker) Pathway dpub00670   One carbon pool by folate dpub00790   Folate biosynthesis dpub01100   Metabolic pathways dpub01240   Biosynthesis of cofactors dpub04981   Folate transport and metabolism Brite KEGG Orthology (KO) [BR:dpub00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00790 Folate biosynthesis     104309372 (DHFR)    00670 One carbon pool by folate     104309372 (DHFR)  09150 Organismal Systems   09154 Digestive system    04981 Folate transport and metabolism     104309372 (DHFR) Enzymes [BR:dpub01000]  1. Oxidoreductases   1.5  Acting on the CH-NH group of donors    1.5.1  With NAD+ or NADP+ as acceptor     1.5.1.3  dihydrofolate reductase      104309372 (DHFR) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  DHFR_1 US2 Motif Other DBs NCBI-GeneID:  104309372 NCBI-ProteinID:  XP_009908993 LinkDB All DBs Position Unknown AA seq 152 aa AA seqDB search MTSTSHVEGKQNALIMGKKTWFSIPEKNRPLKDRINIVLSRELKETPKGAHYLSKSLDDA LALLDSPELKSKVDMVWIVGGTSVYKAAMEKPINHRLFVTRILQEFESDTFFPEINHKDY KLLTEYPGVPAEIQEENGIQYKFEVYEKAVMV NT seq 459 nt NT seq  +upstreamnt  +downstreamnt atgactagcacatcccatgtggaaggtaaacagaatgcactcataatgggtaaaaaaacc tggttctccattcctgagaagaatcgtcccttaaaagacagaattaatatagtgctcagc agggagctcaaggaaaccccaaaaggagcacattatctttccaaaagtctggatgatgct ttagctcttttggactcaccagagttaaaaagcaaagtagacatggtttggatcgtcgga ggcacttcagtttacaaggcagcgatggagaagccaattaatcatcgattgtttgtgacc agaattttgcaggaatttgaaagtgacacattttttccagagatcaaccacaaagactac aaacttctcacagagtacccaggtgtccctgctgaaatccaagaagagaatggcatccag tacaagtttgaagtgtatgagaaagctgtcatggtataa

DBGET integrated database retrieval system