Daphnia pulex (common water flea): DAPPUDRAFT_222109 Help Entry DAPPUDRAFT_222109 CDS       T04347                                  Name (GenBank) hypothetical protein   KO K26502   transmembrane protein 258 Organism dpx  Daphnia pulex (common water flea) Pathway dpx00510   N-Glycan biosynthesis dpx00513   Various types of N-glycan biosynthesis dpx04141   Protein processing in endoplasmic reticulum Module dpx_M00072   N-glycosylation by oligosaccharyltransferase Brite KEGG Orthology (KO) [BR:dpx00001]  09100 Metabolism   09107 Glycan biosynthesis and metabolism    00510 N-Glycan biosynthesis     DAPPUDRAFT_222109    00513 Various types of N-glycan biosynthesis     DAPPUDRAFT_222109  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     DAPPUDRAFT_222109 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ost5 Motif Other DBs NCBI-ProteinID:  EFX86439 JGI:  Dappu1_222109 UniProt:  E9G2V6 LinkDB All DBs Position Unknown AA seq 80 aa AA seqDB search MISVESMSRYVSPVNPSVYPHLSVLLLLIGTFFTAWFFVYEVTSTKITRDLSKELLIAFV ASLFMGFGLMFLMLWVGIYV NT seq 243 nt NT seq  +upstreamnt  +downstreamnt atgattagcgtggagtctatgagtcgttatgtttcaccagtcaatccatctgtttatcca catctttcagttcttttactgctgattggaacattcttcacagcttggttttttgtctat gaagtgaccagcacaaagattacccgggacctgtcaaaagagctgctgatcgcatttgtt gcctccctatttatggggtttggattgatgttccttatgctttgggttggaatatatgtt tga

DBGET integrated database retrieval system