Danio rerio (zebrafish): 100174951 Help Entry 100174951         CDS       T01004                                  Symbol mt2 Name (RefSeq) metallothionein-2   KO K14739   metallothionein 1/2 Organism dre  Danio rerio (zebrafish) Brite KEGG Orthology (KO) [BR:dre00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:dre03019]     100174951 (mt2)    03029 Mitochondrial biogenesis [BR:dre03029]     100174951 (mt2) Messenger RNA biogenesis [BR:dre03019]  Eukaryotic type   mRNA surveillance and transport factors    Factors involved in mRNA localization     Factors that have mRNA localization signals      100174951 (mt2) Mitochondrial biogenesis [BR:dre03029]  Mitochondrial quality control factors   Regulator of mitochondrial biogenesis    Nuclear respiratory factors     100174951 (mt2) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Metallothio Motif Other DBs NCBI-GeneID:  100174951 NCBI-ProteinID:  NP_001124525 ZFIN:  ZDB-GENE-030131-4174 Ensembl:  ENSDARG00000041623 UniProt:  Q7ZSY6 Q1LV07 LinkDB All DBs Position 18:17534636..17536314 Genome browser AA seq 60 aa AA seqDB search MDPCECAKTGTCNCGATCKCTNCQCTTCKKSCCSCCPSGCSKCASGCVCKGNSCGSSCCQ NT seq 183 nt NT seq  +upstreamnt  +downstreamnt atggacccctgcgaatgtgccaagactggaacttgcaactgtggtgctacctgcaagtgc actaattgccagtgtactacctgcaagaagagttgttgttcttgctgcccatctggttgc agcaagtgtgcctctggctgcgtctgcaaaggcaattcctgtggctccagctgctgtcaa tga

DBGET integrated database retrieval system